BLASTX nr result
ID: Glycyrrhiza29_contig00040625
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza29_contig00040625 (314 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KYP63562.1 hypothetical protein KK1_018141 [Cajanus cajan] 202 4e-60 KHM99224.1 Pentatricopeptide repeat-containing protein, mitochon... 201 4e-60 XP_006599001.1 PREDICTED: pentatricopeptide repeat-containing pr... 201 3e-59 XP_004493063.1 PREDICTED: pentatricopeptide repeat-containing pr... 199 2e-58 XP_007161642.1 hypothetical protein PHAVU_001G086300g [Phaseolus... 195 5e-57 XP_019430851.1 PREDICTED: pentatricopeptide repeat-containing pr... 194 1e-56 KOM38336.1 hypothetical protein LR48_Vigan03g171800 [Vigna angul... 194 2e-56 XP_017416196.1 PREDICTED: pentatricopeptide repeat-containing pr... 194 2e-56 XP_014496639.1 PREDICTED: pentatricopeptide repeat-containing pr... 194 2e-56 XP_003624481.1 pentatricopeptide (PPR) repeat protein [Medicago ... 192 7e-56 XP_016162043.1 PREDICTED: pentatricopeptide repeat-containing pr... 184 5e-53 XP_015971184.1 PREDICTED: pentatricopeptide repeat-containing pr... 184 5e-53 XP_002300144.1 phosphoglycerate/bisphosphoglycerate mutase famil... 181 7e-52 XP_011045805.1 PREDICTED: pentatricopeptide repeat-containing pr... 180 2e-51 XP_007215279.1 hypothetical protein PRUPE_ppa004841mg [Prunus pe... 176 5e-51 XP_008341664.2 PREDICTED: pentatricopeptide repeat-containing pr... 171 3e-50 XP_015893918.1 PREDICTED: pentatricopeptide repeat-containing pr... 176 5e-50 ONI20050.1 hypothetical protein PRUPE_3G312400 [Prunus persica] 176 6e-50 CBI21289.3 unnamed protein product, partial [Vitis vinifera] 173 2e-49 XP_008362170.1 PREDICTED: pentatricopeptide repeat-containing pr... 171 3e-49 >KYP63562.1 hypothetical protein KK1_018141 [Cajanus cajan] Length = 624 Score = 202 bits (515), Expect = 4e-60 Identities = 99/104 (95%), Positives = 101/104 (97%) Frame = +1 Query: 1 VELKGRIHVFLVGDKEHPQHEKIYEYWDKLNVKLQELGYMPNVASVLHDVDEEEKGMVLR 180 VELKGRIHVFLVGDKEHPQHEKIYEY DKLNVKLQELGYMPNV SVLHDVDEEEKGMVLR Sbjct: 495 VELKGRIHVFLVGDKEHPQHEKIYEYLDKLNVKLQELGYMPNVTSVLHDVDEEEKGMVLR 554 Query: 181 VHSEKLAIAFGIMNSVPGSIIQIIKNLRICGDCHIAIKLISKIV 312 VHSEKLA+AFGIMNSVPGSII IIKNLRICGDCHIAIKLISK+V Sbjct: 555 VHSEKLAVAFGIMNSVPGSIIHIIKNLRICGDCHIAIKLISKVV 598 >KHM99224.1 Pentatricopeptide repeat-containing protein, mitochondrial, partial [Glycine soja] Length = 534 Score = 201 bits (510), Expect = 4e-60 Identities = 99/104 (95%), Positives = 100/104 (96%) Frame = +1 Query: 1 VELKGRIHVFLVGDKEHPQHEKIYEYWDKLNVKLQELGYMPNVASVLHDVDEEEKGMVLR 180 VELKGRIHVFLVGDKEHPQHEKIYEY DKLNVKLQELGYMPNV SVLHDVDEEEKGMVLR Sbjct: 405 VELKGRIHVFLVGDKEHPQHEKIYEYLDKLNVKLQELGYMPNVTSVLHDVDEEEKGMVLR 464 Query: 181 VHSEKLAIAFGIMNSVPGSIIQIIKNLRICGDCHIAIKLISKIV 312 VHSEKLA+AFGIMNSVPGSIIQIIKNLRICGDCH AIKLISK V Sbjct: 465 VHSEKLAVAFGIMNSVPGSIIQIIKNLRICGDCHSAIKLISKAV 508 >XP_006599001.1 PREDICTED: pentatricopeptide repeat-containing protein At3g26782, mitochondrial [Glycine max] KRH06847.1 hypothetical protein GLYMA_16G049800 [Glycine max] Length = 653 Score = 201 bits (510), Expect = 3e-59 Identities = 99/104 (95%), Positives = 100/104 (96%) Frame = +1 Query: 1 VELKGRIHVFLVGDKEHPQHEKIYEYWDKLNVKLQELGYMPNVASVLHDVDEEEKGMVLR 180 VELKGRIHVFLVGDKEHPQHEKIYEY DKLNVKLQELGYMPNV SVLHDVDEEEKGMVLR Sbjct: 524 VELKGRIHVFLVGDKEHPQHEKIYEYLDKLNVKLQELGYMPNVTSVLHDVDEEEKGMVLR 583 Query: 181 VHSEKLAIAFGIMNSVPGSIIQIIKNLRICGDCHIAIKLISKIV 312 VHSEKLA+AFGIMNSVPGSIIQIIKNLRICGDCH AIKLISK V Sbjct: 584 VHSEKLAVAFGIMNSVPGSIIQIIKNLRICGDCHSAIKLISKAV 627 >XP_004493063.1 PREDICTED: pentatricopeptide repeat-containing protein At3g26782, mitochondrial [Cicer arietinum] Length = 663 Score = 199 bits (505), Expect = 2e-58 Identities = 97/103 (94%), Positives = 100/103 (97%) Frame = +1 Query: 4 ELKGRIHVFLVGDKEHPQHEKIYEYWDKLNVKLQELGYMPNVASVLHDVDEEEKGMVLRV 183 E KGRIHVFLVGDKEHPQHEKIYEY D+LNVKLQELGYMPNV SVLHDVDEEEKGMVLRV Sbjct: 535 EHKGRIHVFLVGDKEHPQHEKIYEYLDELNVKLQELGYMPNVTSVLHDVDEEEKGMVLRV 594 Query: 184 HSEKLAIAFGIMNSVPGSIIQIIKNLRICGDCHIAIKLISKIV 312 HSEKLA+AFGIMNSVPGS+IQIIKNLRICGDCHIAIKLISKIV Sbjct: 595 HSEKLAVAFGIMNSVPGSVIQIIKNLRICGDCHIAIKLISKIV 637 >XP_007161642.1 hypothetical protein PHAVU_001G086300g [Phaseolus vulgaris] ESW33636.1 hypothetical protein PHAVU_001G086300g [Phaseolus vulgaris] Length = 669 Score = 195 bits (496), Expect = 5e-57 Identities = 95/104 (91%), Positives = 99/104 (95%) Frame = +1 Query: 1 VELKGRIHVFLVGDKEHPQHEKIYEYWDKLNVKLQELGYMPNVASVLHDVDEEEKGMVLR 180 VELKGRIHVFLVGDKEHPQH+KIYEY DKLNVKLQELGYMP + SVLHDVDEEEKGMVLR Sbjct: 540 VELKGRIHVFLVGDKEHPQHKKIYEYLDKLNVKLQELGYMPYLTSVLHDVDEEEKGMVLR 599 Query: 181 VHSEKLAIAFGIMNSVPGSIIQIIKNLRICGDCHIAIKLISKIV 312 VHSEKLA+ FGIMNSVPGSII IIKNLRICGDCHIAIKLISK+V Sbjct: 600 VHSEKLAVCFGIMNSVPGSIIHIIKNLRICGDCHIAIKLISKVV 643 >XP_019430851.1 PREDICTED: pentatricopeptide repeat-containing protein At3g26782, mitochondrial [Lupinus angustifolius] Length = 679 Score = 194 bits (493), Expect = 1e-56 Identities = 93/104 (89%), Positives = 98/104 (94%) Frame = +1 Query: 1 VELKGRIHVFLVGDKEHPQHEKIYEYWDKLNVKLQELGYMPNVASVLHDVDEEEKGMVLR 180 VELKGR+HVFLVGDKEHPQHEK YEY DKLNVKLQELGY PN+ SVLHDVDEEEKGM+LR Sbjct: 550 VELKGRVHVFLVGDKEHPQHEKTYEYLDKLNVKLQELGYAPNLTSVLHDVDEEEKGMLLR 609 Query: 181 VHSEKLAIAFGIMNSVPGSIIQIIKNLRICGDCHIAIKLISKIV 312 VHSEKLA+AFGIMNSVPGS IQIIKNLRICGDCHI IKLISK+V Sbjct: 610 VHSEKLAVAFGIMNSVPGSTIQIIKNLRICGDCHIVIKLISKVV 653 >KOM38336.1 hypothetical protein LR48_Vigan03g171800 [Vigna angularis] Length = 661 Score = 194 bits (492), Expect = 2e-56 Identities = 93/104 (89%), Positives = 97/104 (93%) Frame = +1 Query: 1 VELKGRIHVFLVGDKEHPQHEKIYEYWDKLNVKLQELGYMPNVASVLHDVDEEEKGMVLR 180 VELKGR+HVFLVGDKEHPQHEKIYEY DKLNVKLQ LGYMPN+ SVLHDVDEEEKGMVLR Sbjct: 532 VELKGRVHVFLVGDKEHPQHEKIYEYLDKLNVKLQALGYMPNLTSVLHDVDEEEKGMVLR 591 Query: 181 VHSEKLAIAFGIMNSVPGSIIQIIKNLRICGDCHIAIKLISKIV 312 VHSEKLA+ FGIMNSVPGS+I IIKNLRICGDCHIAIK ISK V Sbjct: 592 VHSEKLAVCFGIMNSVPGSVIHIIKNLRICGDCHIAIKFISKAV 635 >XP_017416196.1 PREDICTED: pentatricopeptide repeat-containing protein At3g26782, mitochondrial [Vigna angularis] BAT84733.1 hypothetical protein VIGAN_04217500 [Vigna angularis var. angularis] Length = 668 Score = 194 bits (492), Expect = 2e-56 Identities = 93/104 (89%), Positives = 97/104 (93%) Frame = +1 Query: 1 VELKGRIHVFLVGDKEHPQHEKIYEYWDKLNVKLQELGYMPNVASVLHDVDEEEKGMVLR 180 VELKGR+HVFLVGDKEHPQHEKIYEY DKLNVKLQ LGYMPN+ SVLHDVDEEEKGMVLR Sbjct: 539 VELKGRVHVFLVGDKEHPQHEKIYEYLDKLNVKLQALGYMPNLTSVLHDVDEEEKGMVLR 598 Query: 181 VHSEKLAIAFGIMNSVPGSIIQIIKNLRICGDCHIAIKLISKIV 312 VHSEKLA+ FGIMNSVPGS+I IIKNLRICGDCHIAIK ISK V Sbjct: 599 VHSEKLAVCFGIMNSVPGSVIHIIKNLRICGDCHIAIKFISKAV 642 >XP_014496639.1 PREDICTED: pentatricopeptide repeat-containing protein At3g26782, mitochondrial [Vigna radiata var. radiata] Length = 668 Score = 194 bits (492), Expect = 2e-56 Identities = 93/104 (89%), Positives = 97/104 (93%) Frame = +1 Query: 1 VELKGRIHVFLVGDKEHPQHEKIYEYWDKLNVKLQELGYMPNVASVLHDVDEEEKGMVLR 180 VELKGR+HVFLVGDKEHPQHEKIYEY DKLNVKLQ LGYMPN+ SVLHDVDEEEKGMVLR Sbjct: 539 VELKGRVHVFLVGDKEHPQHEKIYEYLDKLNVKLQALGYMPNLTSVLHDVDEEEKGMVLR 598 Query: 181 VHSEKLAIAFGIMNSVPGSIIQIIKNLRICGDCHIAIKLISKIV 312 VHSEKLA+ FGIMNSVPGS+I IIKNLRICGDCHIAIK ISK V Sbjct: 599 VHSEKLAVCFGIMNSVPGSVIHIIKNLRICGDCHIAIKFISKAV 642 >XP_003624481.1 pentatricopeptide (PPR) repeat protein [Medicago truncatula] ABD32557.1 Tetratricopeptide-like helical [Medicago truncatula] AES80699.1 pentatricopeptide (PPR) repeat protein [Medicago truncatula] Length = 672 Score = 192 bits (488), Expect = 7e-56 Identities = 93/104 (89%), Positives = 99/104 (95%) Frame = +1 Query: 1 VELKGRIHVFLVGDKEHPQHEKIYEYWDKLNVKLQELGYMPNVASVLHDVDEEEKGMVLR 180 VE KGR+HVFLVGDKEHPQHEKIYEY D+LNVKLQE+GYMPNV SVL+DVD EEKGMVLR Sbjct: 543 VEHKGRVHVFLVGDKEHPQHEKIYEYLDELNVKLQEVGYMPNVTSVLYDVDVEEKGMVLR 602 Query: 181 VHSEKLAIAFGIMNSVPGSIIQIIKNLRICGDCHIAIKLISKIV 312 VHSEKLA+AFGIMNSVPGS+IQIIKNLRICGDCH AIKLISKIV Sbjct: 603 VHSEKLAVAFGIMNSVPGSVIQIIKNLRICGDCHFAIKLISKIV 646 >XP_016162043.1 PREDICTED: pentatricopeptide repeat-containing protein At3g26782, mitochondrial [Arachis ipaensis] Length = 669 Score = 184 bits (468), Expect = 5e-53 Identities = 89/103 (86%), Positives = 95/103 (92%) Frame = +1 Query: 1 VELKGRIHVFLVGDKEHPQHEKIYEYWDKLNVKLQELGYMPNVASVLHDVDEEEKGMVLR 180 VELKGRIHVFLVGDKEHPQH KIYEY DKLNVKLQ LGY+PNV SVLHD+D+EEKGMVLR Sbjct: 540 VELKGRIHVFLVGDKEHPQHVKIYEYLDKLNVKLQGLGYVPNVTSVLHDIDDEEKGMVLR 599 Query: 181 VHSEKLAIAFGIMNSVPGSIIQIIKNLRICGDCHIAIKLISKI 309 VHSEKLA+AFGIMNSVP + IQIIKNLRICGDCH IKLISK+ Sbjct: 600 VHSEKLAVAFGIMNSVPCATIQIIKNLRICGDCHAVIKLISKV 642 >XP_015971184.1 PREDICTED: pentatricopeptide repeat-containing protein At3g26782, mitochondrial [Arachis duranensis] Length = 669 Score = 184 bits (468), Expect = 5e-53 Identities = 89/103 (86%), Positives = 95/103 (92%) Frame = +1 Query: 1 VELKGRIHVFLVGDKEHPQHEKIYEYWDKLNVKLQELGYMPNVASVLHDVDEEEKGMVLR 180 VELKGRIHVFLVGDKEHPQH KIYEY DKLNVKLQ LGY+PNV SVLHD+D+EEKGMVLR Sbjct: 540 VELKGRIHVFLVGDKEHPQHVKIYEYLDKLNVKLQGLGYVPNVTSVLHDIDDEEKGMVLR 599 Query: 181 VHSEKLAIAFGIMNSVPGSIIQIIKNLRICGDCHIAIKLISKI 309 VHSEKLA+AFGIMNSVP + IQIIKNLRICGDCH IKLISK+ Sbjct: 600 VHSEKLAVAFGIMNSVPCATIQIIKNLRICGDCHAVIKLISKV 642 >XP_002300144.1 phosphoglycerate/bisphosphoglycerate mutase family protein [Populus trichocarpa] EEE84949.1 phosphoglycerate/bisphosphoglycerate mutase family protein [Populus trichocarpa] Length = 666 Score = 181 bits (460), Expect = 7e-52 Identities = 83/104 (79%), Positives = 97/104 (93%) Frame = +1 Query: 1 VELKGRIHVFLVGDKEHPQHEKIYEYWDKLNVKLQELGYMPNVASVLHDVDEEEKGMVLR 180 VELKGR+HVFLVGDKEHPQHEKIY+Y ++L+VKLQE GY+PN+ASVLHDVDEEEK M++R Sbjct: 537 VELKGRVHVFLVGDKEHPQHEKIYKYLEELSVKLQEAGYVPNMASVLHDVDEEEKEMIVR 596 Query: 181 VHSEKLAIAFGIMNSVPGSIIQIIKNLRICGDCHIAIKLISKIV 312 VHSEKLA+AFG+MNS+PGS I +IKNLR+CGDCH IKLISKIV Sbjct: 597 VHSEKLAVAFGVMNSIPGSTIHVIKNLRVCGDCHTVIKLISKIV 640 >XP_011045805.1 PREDICTED: pentatricopeptide repeat-containing protein At3g26782, mitochondrial [Populus euphratica] XP_011045806.1 PREDICTED: pentatricopeptide repeat-containing protein At3g26782, mitochondrial [Populus euphratica] Length = 666 Score = 180 bits (456), Expect = 2e-51 Identities = 82/104 (78%), Positives = 97/104 (93%) Frame = +1 Query: 1 VELKGRIHVFLVGDKEHPQHEKIYEYWDKLNVKLQELGYMPNVASVLHDVDEEEKGMVLR 180 VELKGR+H+FLVGDKEHPQHEKIY+Y ++L+VKLQE GY+PN+ASVLHDVDEEEK MV++ Sbjct: 537 VELKGRVHIFLVGDKEHPQHEKIYKYLEELSVKLQEAGYVPNMASVLHDVDEEEKEMVVQ 596 Query: 181 VHSEKLAIAFGIMNSVPGSIIQIIKNLRICGDCHIAIKLISKIV 312 +HSEKLA+AFG+MNSVPGS I +IKNLR+CGDCH IKLISKIV Sbjct: 597 IHSEKLAVAFGVMNSVPGSTIHVIKNLRVCGDCHTVIKLISKIV 640 >XP_007215279.1 hypothetical protein PRUPE_ppa004841mg [Prunus persica] Length = 489 Score = 176 bits (446), Expect = 5e-51 Identities = 81/104 (77%), Positives = 94/104 (90%) Frame = +1 Query: 1 VELKGRIHVFLVGDKEHPQHEKIYEYWDKLNVKLQELGYMPNVASVLHDVDEEEKGMVLR 180 VELKG++H+FLVGD+EHPQHE+IYEY +KL +KL E+GY PNV SVLHDVDEEEK MVLR Sbjct: 360 VELKGKVHLFLVGDREHPQHERIYEYLEKLTIKLLEVGYAPNVTSVLHDVDEEEKEMVLR 419 Query: 181 VHSEKLAIAFGIMNSVPGSIIQIIKNLRICGDCHIAIKLISKIV 312 VHSEKLA+AFGIMNSVPG+ IQIIKNLR+C DCH IKL+SK+V Sbjct: 420 VHSEKLAVAFGIMNSVPGTTIQIIKNLRVCADCHTVIKLLSKVV 463 >XP_008341664.2 PREDICTED: pentatricopeptide repeat-containing protein At3g26782, mitochondrial-like [Malus domestica] Length = 383 Score = 171 bits (434), Expect = 3e-50 Identities = 79/104 (75%), Positives = 94/104 (90%) Frame = +1 Query: 1 VELKGRIHVFLVGDKEHPQHEKIYEYWDKLNVKLQELGYMPNVASVLHDVDEEEKGMVLR 180 VEL+G +H+FLVGD+EHPQHEKIYEY +KL +KLQE+GY PN++SVLHDVDEEEK MVLR Sbjct: 254 VELRGIVHLFLVGDREHPQHEKIYEYLEKLTIKLQEVGYAPNISSVLHDVDEEEKEMVLR 313 Query: 181 VHSEKLAIAFGIMNSVPGSIIQIIKNLRICGDCHIAIKLISKIV 312 VHSEKLA+AFGIMNSV G+ IQIIKNLR+C +CH IKLI+K+V Sbjct: 314 VHSEKLAVAFGIMNSVSGATIQIIKNLRVCANCHTVIKLITKVV 357 >XP_015893918.1 PREDICTED: pentatricopeptide repeat-containing protein At3g26782, mitochondrial [Ziziphus jujuba] XP_015893919.1 PREDICTED: pentatricopeptide repeat-containing protein At3g26782, mitochondrial [Ziziphus jujuba] XP_015893921.1 PREDICTED: pentatricopeptide repeat-containing protein At3g26782, mitochondrial [Ziziphus jujuba] XP_015893922.1 PREDICTED: pentatricopeptide repeat-containing protein At3g26782, mitochondrial [Ziziphus jujuba] XP_015893923.1 PREDICTED: pentatricopeptide repeat-containing protein At3g26782, mitochondrial [Ziziphus jujuba] XP_015893924.1 PREDICTED: pentatricopeptide repeat-containing protein At3g26782, mitochondrial [Ziziphus jujuba] XP_015893925.1 PREDICTED: pentatricopeptide repeat-containing protein At3g26782, mitochondrial [Ziziphus jujuba] Length = 663 Score = 176 bits (447), Expect = 5e-50 Identities = 80/104 (76%), Positives = 94/104 (90%) Frame = +1 Query: 1 VELKGRIHVFLVGDKEHPQHEKIYEYWDKLNVKLQELGYMPNVASVLHDVDEEEKGMVLR 180 VELKGR+H+FLVGD+EHP+HE+ Y+Y +KL KLQE+GY PN+ASV+HDVDEEEK M LR Sbjct: 534 VELKGRVHIFLVGDREHPEHEQTYQYLEKLTAKLQEVGYTPNMASVVHDVDEEEKEMALR 593 Query: 181 VHSEKLAIAFGIMNSVPGSIIQIIKNLRICGDCHIAIKLISKIV 312 +HSEKLA+AFGIMNSVPGS IQIIKNLR+CGDCH IKLISK+V Sbjct: 594 IHSEKLAVAFGIMNSVPGSTIQIIKNLRVCGDCHTVIKLISKVV 637 >ONI20050.1 hypothetical protein PRUPE_3G312400 [Prunus persica] Length = 653 Score = 176 bits (446), Expect = 6e-50 Identities = 81/104 (77%), Positives = 94/104 (90%) Frame = +1 Query: 1 VELKGRIHVFLVGDKEHPQHEKIYEYWDKLNVKLQELGYMPNVASVLHDVDEEEKGMVLR 180 VELKG++H+FLVGD+EHPQHE+IYEY +KL +KL E+GY PNV SVLHDVDEEEK MVLR Sbjct: 524 VELKGKVHLFLVGDREHPQHERIYEYLEKLTIKLLEVGYAPNVTSVLHDVDEEEKEMVLR 583 Query: 181 VHSEKLAIAFGIMNSVPGSIIQIIKNLRICGDCHIAIKLISKIV 312 VHSEKLA+AFGIMNSVPG+ IQIIKNLR+C DCH IKL+SK+V Sbjct: 584 VHSEKLAVAFGIMNSVPGTTIQIIKNLRVCADCHTVIKLLSKVV 627 >CBI21289.3 unnamed protein product, partial [Vitis vinifera] Length = 581 Score = 173 bits (439), Expect = 2e-49 Identities = 80/104 (76%), Positives = 95/104 (91%) Frame = +1 Query: 1 VELKGRIHVFLVGDKEHPQHEKIYEYWDKLNVKLQELGYMPNVASVLHDVDEEEKGMVLR 180 V++KGR+HVFLVGD+EHPQHEKIYEY +KL++KLQE+GY+P++ SVLHDV EEK MVLR Sbjct: 452 VDIKGRVHVFLVGDREHPQHEKIYEYLEKLSMKLQEVGYVPDMTSVLHDVGHEEKEMVLR 511 Query: 181 VHSEKLAIAFGIMNSVPGSIIQIIKNLRICGDCHIAIKLISKIV 312 VHSEKLA+AFGIMN+VPG+ I IIKNLR+CGDCH AIK ISKIV Sbjct: 512 VHSEKLAVAFGIMNTVPGTTIHIIKNLRVCGDCHTAIKFISKIV 555 >XP_008362170.1 PREDICTED: pentatricopeptide repeat-containing protein At3g26782, mitochondrial-like [Malus domestica] Length = 486 Score = 171 bits (434), Expect = 3e-49 Identities = 79/104 (75%), Positives = 94/104 (90%) Frame = +1 Query: 1 VELKGRIHVFLVGDKEHPQHEKIYEYWDKLNVKLQELGYMPNVASVLHDVDEEEKGMVLR 180 VEL+G +H+FLVGD+EHPQHEKIYEY +KL +KLQE+GY PN++SVLHDVDEEEK MVLR Sbjct: 357 VELRGIVHLFLVGDREHPQHEKIYEYLEKLTIKLQEVGYAPNISSVLHDVDEEEKEMVLR 416 Query: 181 VHSEKLAIAFGIMNSVPGSIIQIIKNLRICGDCHIAIKLISKIV 312 VHSEKLA+AFGIMNSV G+ IQIIKNLR+C +CH IKLI+K+V Sbjct: 417 VHSEKLAVAFGIMNSVSGATIQIIKNLRVCANCHTVIKLITKVV 460