BLASTX nr result
ID: Glycyrrhiza29_contig00040353
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza29_contig00040353 (295 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_003534744.1 PREDICTED: pentatricopeptide repeat-containing pr... 81 7e-16 KHN40797.1 Pentatricopeptide repeat-containing protein, chloropl... 81 7e-16 XP_004486343.1 PREDICTED: pentatricopeptide repeat-containing pr... 80 1e-15 BAT87559.1 hypothetical protein VIGAN_05094200 [Vigna angularis ... 73 1e-14 XP_019440002.1 PREDICTED: pentatricopeptide repeat-containing pr... 77 2e-14 XP_013462936.1 pentatricopeptide (PPR) repeat protein [Medicago ... 77 3e-14 KRH36593.1 hypothetical protein GLYMA_09G013500 [Glycine max] 74 2e-13 XP_007213618.1 hypothetical protein PRUPE_ppa002169mg [Prunus pe... 74 2e-13 XP_014617315.1 PREDICTED: pentatricopeptide repeat-containing pr... 74 2e-13 XP_008224621.1 PREDICTED: pentatricopeptide repeat-containing pr... 74 3e-13 XP_003610579.1 pentatricopeptide (PPR) repeat protein [Medicago ... 74 3e-13 XP_014516891.1 PREDICTED: pentatricopeptide repeat-containing pr... 74 3e-13 BAT87560.1 hypothetical protein VIGAN_05094300 [Vigna angularis ... 74 3e-13 XP_017434951.1 PREDICTED: pentatricopeptide repeat-containing pr... 74 3e-13 XP_017434330.1 PREDICTED: pentatricopeptide repeat-containing pr... 73 6e-13 XP_015879093.1 PREDICTED: pentatricopeptide repeat-containing pr... 72 8e-13 XP_010252754.1 PREDICTED: pentatricopeptide repeat-containing pr... 72 8e-13 XP_004507605.1 PREDICTED: pentatricopeptide repeat-containing pr... 72 1e-12 XP_010087648.1 hypothetical protein L484_010599 [Morus notabilis... 72 1e-12 EOY28969.1 Pentatricopeptide (PPR) repeat-containing protein [Th... 72 1e-12 >XP_003534744.1 PREDICTED: pentatricopeptide repeat-containing protein At4g16390, chloroplastic-like [Glycine max] KRH36594.1 hypothetical protein GLYMA_09G013600 [Glycine max] Length = 705 Score = 81.3 bits (199), Expect = 7e-16 Identities = 38/57 (66%), Positives = 46/57 (80%) Frame = -3 Query: 293 SHLKELGAPLQEAPDKAGWFLTTQVAAKSWLESRGSSETVAALDSPVLGAPTMALHF 123 SHL+EL AP +APDKAGWFL T+ AAKSWLESRGS+ET+ L+S V GA T+AL + Sbjct: 648 SHLRELNAPFHQAPDKAGWFLVTKEAAKSWLESRGSAETIDDLNSQVSGASTVALQY 704 >KHN40797.1 Pentatricopeptide repeat-containing protein, chloroplastic [Glycine soja] Length = 1127 Score = 81.3 bits (199), Expect = 7e-16 Identities = 38/57 (66%), Positives = 46/57 (80%) Frame = -3 Query: 293 SHLKELGAPLQEAPDKAGWFLTTQVAAKSWLESRGSSETVAALDSPVLGAPTMALHF 123 SHL+EL AP +APDKAGWFL T+ AAKSWLESRGS+ET+ L+S V GA T+AL + Sbjct: 1070 SHLRELNAPFHQAPDKAGWFLVTKEAAKSWLESRGSAETIDDLNSQVSGASTVALQY 1126 >XP_004486343.1 PREDICTED: pentatricopeptide repeat-containing protein At4g16390, chloroplastic-like [Cicer arietinum] Length = 692 Score = 80.5 bits (197), Expect = 1e-15 Identities = 38/57 (66%), Positives = 47/57 (82%) Frame = -3 Query: 293 SHLKELGAPLQEAPDKAGWFLTTQVAAKSWLESRGSSETVAALDSPVLGAPTMALHF 123 SHLKEL AP +E P+K GWFL T+ AAKSWLESRGS++++A LDS VL AP+MAL + Sbjct: 636 SHLKELNAPFREDPNKDGWFLVTKEAAKSWLESRGSTKSIAPLDSLVLNAPSMALPY 692 >BAT87559.1 hypothetical protein VIGAN_05094200 [Vigna angularis var. angularis] Length = 101 Score = 72.8 bits (177), Expect = 1e-14 Identities = 34/55 (61%), Positives = 42/55 (76%) Frame = -3 Query: 293 SHLKELGAPLQEAPDKAGWFLTTQVAAKSWLESRGSSETVAALDSPVLGAPTMAL 129 SHLKEL AP EA D GWFL T+ AA SWL+SRGS+E++A+L++ LG P MAL Sbjct: 47 SHLKELNAPFYEAADNPGWFLVTKPAAISWLQSRGSTESIASLNTLALGVPAMAL 101 >XP_019440002.1 PREDICTED: pentatricopeptide repeat-containing protein At4g16390, chloroplastic-like [Lupinus angustifolius] OIW13865.1 hypothetical protein TanjilG_31754 [Lupinus angustifolius] Length = 695 Score = 77.0 bits (188), Expect = 2e-14 Identities = 36/56 (64%), Positives = 43/56 (76%) Frame = -3 Query: 293 SHLKELGAPLQEAPDKAGWFLTTQVAAKSWLESRGSSETVAALDSPVLGAPTMALH 126 S+LKEL AP EAP++AGWFL T+ AAKSWLESR S+E ++A S LG P MALH Sbjct: 639 SYLKELNAPFHEAPEQAGWFLMTKAAAKSWLESRSSTEPISASSSMDLGVPAMALH 694 >XP_013462936.1 pentatricopeptide (PPR) repeat protein [Medicago truncatula] KEH36981.1 pentatricopeptide (PPR) repeat protein [Medicago truncatula] Length = 687 Score = 76.6 bits (187), Expect = 3e-14 Identities = 37/57 (64%), Positives = 45/57 (78%) Frame = -3 Query: 293 SHLKELGAPLQEAPDKAGWFLTTQVAAKSWLESRGSSETVAALDSPVLGAPTMALHF 123 SHLKEL AP EA ++ GWFL T+ AAKSWLESRGS+++VA LDS VL AP+M L + Sbjct: 631 SHLKELNAPFCEAQNEVGWFLVTKEAAKSWLESRGSTKSVATLDSLVLSAPSMTLTY 687 >KRH36593.1 hypothetical protein GLYMA_09G013500 [Glycine max] Length = 693 Score = 73.9 bits (180), Expect = 2e-13 Identities = 37/55 (67%), Positives = 43/55 (78%) Frame = -3 Query: 293 SHLKELGAPLQEAPDKAGWFLTTQVAAKSWLESRGSSETVAALDSPVLGAPTMAL 129 SHLKEL AP E+ KAGWFL T+ AAKSWLESR S+E++A L+S VLG PTM L Sbjct: 641 SHLKELNAPFHES--KAGWFLVTKAAAKSWLESRDSTESIAGLNSLVLGVPTMVL 693 >XP_007213618.1 hypothetical protein PRUPE_ppa002169mg [Prunus persica] ONI09720.1 hypothetical protein PRUPE_4G005200 [Prunus persica] Length = 706 Score = 73.9 bits (180), Expect = 2e-13 Identities = 35/42 (83%), Positives = 36/42 (85%) Frame = -3 Query: 293 SHLKELGAPLQEAPDKAGWFLTTQVAAKSWLESRGSSETVAA 168 SHLKEL AP EAPDKAGWFLTT+VA KSWLESR SSE VAA Sbjct: 665 SHLKELNAPFHEAPDKAGWFLTTKVAVKSWLESRSSSELVAA 706 >XP_014617315.1 PREDICTED: pentatricopeptide repeat-containing protein At4g16390, chloroplastic-like [Glycine max] KHN40798.1 Pentatricopeptide repeat-containing protein, chloroplastic [Glycine soja] Length = 1017 Score = 73.9 bits (180), Expect = 2e-13 Identities = 37/55 (67%), Positives = 43/55 (78%) Frame = -3 Query: 293 SHLKELGAPLQEAPDKAGWFLTTQVAAKSWLESRGSSETVAALDSPVLGAPTMAL 129 SHLKEL AP E+ KAGWFL T+ AAKSWLESR S+E++A L+S VLG PTM L Sbjct: 965 SHLKELNAPFHES--KAGWFLVTKAAAKSWLESRDSTESIAGLNSLVLGVPTMVL 1017 >XP_008224621.1 PREDICTED: pentatricopeptide repeat-containing protein At4g16390, chloroplastic [Prunus mume] Length = 706 Score = 73.6 bits (179), Expect = 3e-13 Identities = 35/42 (83%), Positives = 36/42 (85%) Frame = -3 Query: 293 SHLKELGAPLQEAPDKAGWFLTTQVAAKSWLESRGSSETVAA 168 SHLKEL AP EAPDKAGWFLTT+VA KSWLESR SSE VAA Sbjct: 665 SHLKELNAPFHEAPDKAGWFLTTKVAVKSWLESRSSSEFVAA 706 >XP_003610579.1 pentatricopeptide (PPR) repeat protein [Medicago truncatula] AES92776.1 pentatricopeptide (PPR) repeat protein [Medicago truncatula] Length = 706 Score = 73.6 bits (179), Expect = 3e-13 Identities = 33/42 (78%), Positives = 38/42 (90%) Frame = -3 Query: 293 SHLKELGAPLQEAPDKAGWFLTTQVAAKSWLESRGSSETVAA 168 SH+KEL AP +E+PDKAGWFLTTQVA KSW+ESRGSS+ VAA Sbjct: 665 SHMKELDAPFRESPDKAGWFLTTQVAVKSWMESRGSSKLVAA 706 >XP_014516891.1 PREDICTED: pentatricopeptide repeat-containing protein At4g16390, chloroplastic-like [Vigna radiata var. radiata] Length = 713 Score = 73.6 bits (179), Expect = 3e-13 Identities = 34/57 (59%), Positives = 43/57 (75%) Frame = -3 Query: 293 SHLKELGAPLQEAPDKAGWFLTTQVAAKSWLESRGSSETVAALDSPVLGAPTMALHF 123 SHL+EL AP EAPDKAGWFL T+ AAKSWLE R S+E++A L+ V G T+A+ + Sbjct: 656 SHLRELNAPFHEAPDKAGWFLVTKDAAKSWLEYRSSTESIADLNFQVSGGSTLAVQY 712 >BAT87560.1 hypothetical protein VIGAN_05094300 [Vigna angularis var. angularis] Length = 714 Score = 73.6 bits (179), Expect = 3e-13 Identities = 34/57 (59%), Positives = 43/57 (75%) Frame = -3 Query: 293 SHLKELGAPLQEAPDKAGWFLTTQVAAKSWLESRGSSETVAALDSPVLGAPTMALHF 123 SHL+EL AP EAPDKAGWFL T+ AAKSWLE R S+E++A L+ V G T+A+ + Sbjct: 657 SHLRELNAPFHEAPDKAGWFLVTKDAAKSWLEYRSSTESIADLNFQVSGGSTLAVQY 713 >XP_017434951.1 PREDICTED: pentatricopeptide repeat-containing protein At4g16390, chloroplastic-like [Vigna angularis] KOM53346.1 hypothetical protein LR48_Vigan09g200500 [Vigna angularis] Length = 714 Score = 73.6 bits (179), Expect = 3e-13 Identities = 34/57 (59%), Positives = 43/57 (75%) Frame = -3 Query: 293 SHLKELGAPLQEAPDKAGWFLTTQVAAKSWLESRGSSETVAALDSPVLGAPTMALHF 123 SHL+EL AP EAPDKAGWFL T+ AAKSWLE R S+E++A L+ V G T+A+ + Sbjct: 657 SHLRELNAPFHEAPDKAGWFLVTKDAAKSWLEYRSSTESIADLNFQVSGGSTLAVQY 713 >XP_017434330.1 PREDICTED: pentatricopeptide repeat-containing protein At4g16390, chloroplastic-like [Vigna angularis] KOM53345.1 hypothetical protein LR48_Vigan09g200400 [Vigna angularis] Length = 1020 Score = 72.8 bits (177), Expect = 6e-13 Identities = 34/55 (61%), Positives = 42/55 (76%) Frame = -3 Query: 293 SHLKELGAPLQEAPDKAGWFLTTQVAAKSWLESRGSSETVAALDSPVLGAPTMAL 129 SHLKEL AP EA D GWFL T+ AA SWL+SRGS+E++A+L++ LG P MAL Sbjct: 966 SHLKELNAPFYEAADNPGWFLVTKPAAISWLQSRGSTESIASLNTLALGVPAMAL 1020 >XP_015879093.1 PREDICTED: pentatricopeptide repeat-containing protein At4g16390, chloroplastic [Ziziphus jujuba] Length = 703 Score = 72.4 bits (176), Expect = 8e-13 Identities = 33/42 (78%), Positives = 36/42 (85%) Frame = -3 Query: 293 SHLKELGAPLQEAPDKAGWFLTTQVAAKSWLESRGSSETVAA 168 SHLKEL AP EAPDK GWFLTT+VAAKSWL+SR SSE +AA Sbjct: 662 SHLKELNAPFHEAPDKVGWFLTTKVAAKSWLDSRNSSELIAA 703 >XP_010252754.1 PREDICTED: pentatricopeptide repeat-containing protein At4g16390, chloroplastic [Nelumbo nucifera] XP_010252755.1 PREDICTED: pentatricopeptide repeat-containing protein At4g16390, chloroplastic [Nelumbo nucifera] Length = 715 Score = 72.4 bits (176), Expect = 8e-13 Identities = 34/42 (80%), Positives = 36/42 (85%) Frame = -3 Query: 293 SHLKELGAPLQEAPDKAGWFLTTQVAAKSWLESRGSSETVAA 168 SHLKEL AP EAPDKAGWFLTT+VAAKSWLESR S + VAA Sbjct: 674 SHLKELNAPFHEAPDKAGWFLTTKVAAKSWLESRSSPDIVAA 715 >XP_004507605.1 PREDICTED: pentatricopeptide repeat-containing protein At4g16390, chloroplastic [Cicer arietinum] Length = 688 Score = 72.0 bits (175), Expect = 1e-12 Identities = 34/42 (80%), Positives = 35/42 (83%) Frame = -3 Query: 293 SHLKELGAPLQEAPDKAGWFLTTQVAAKSWLESRGSSETVAA 168 SHLKEL AP EAPDKAGWFLTTQVA KSW+E R SSE VAA Sbjct: 647 SHLKELNAPFHEAPDKAGWFLTTQVAVKSWMEPRRSSELVAA 688 >XP_010087648.1 hypothetical protein L484_010599 [Morus notabilis] EXB29541.1 hypothetical protein L484_010599 [Morus notabilis] Length = 699 Score = 72.0 bits (175), Expect = 1e-12 Identities = 34/42 (80%), Positives = 36/42 (85%) Frame = -3 Query: 293 SHLKELGAPLQEAPDKAGWFLTTQVAAKSWLESRGSSETVAA 168 SHLKEL AP +APD AGWFLTT+VAAKSWLESR SSE VAA Sbjct: 658 SHLKELDAPFHDAPDNAGWFLTTKVAAKSWLESRSSSEEVAA 699 >EOY28969.1 Pentatricopeptide (PPR) repeat-containing protein [Theobroma cacao] Length = 700 Score = 72.0 bits (175), Expect = 1e-12 Identities = 34/42 (80%), Positives = 35/42 (83%) Frame = -3 Query: 293 SHLKELGAPLQEAPDKAGWFLTTQVAAKSWLESRGSSETVAA 168 SHLKEL AP EAPDK GWFLTTQVAAKSWLESR S + VAA Sbjct: 659 SHLKELDAPFHEAPDKVGWFLTTQVAAKSWLESRSSPDLVAA 700