BLASTX nr result
ID: Glycyrrhiza29_contig00040252
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza29_contig00040252 (364 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017249682.1 PREDICTED: metallothionein-like protein type 2 [D... 77 3e-16 XP_011089462.1 PREDICTED: metallothionein-like protein 1 [Sesamu... 70 1e-13 XP_011089466.1 PREDICTED: metallothionein-like protein 1 [Sesamu... 68 8e-13 EYU18964.1 hypothetical protein MIMGU_mgv1a017480mg [Erythranthe... 67 2e-12 APX42724.1 MT2b [Hevea brasiliensis] 67 3e-12 XP_012827917.1 PREDICTED: metallothionein-like protein 1 [Erythr... 65 1e-11 CAA36249.1 metallothionein [Erythranthe guttata] 65 1e-11 XP_017231083.1 PREDICTED: metallothionein-like protein type 2 [D... 65 1e-11 XP_017234985.1 PREDICTED: metallothionein-like protein 1 [Daucus... 63 7e-11 ABD73299.1 metallothionein-like protein [Panax ginseng] 63 7e-11 KZV06627.1 hypothetical protein F511_45894 [Dorcoceras hygrometr... 63 1e-10 AAB70560.1 metallothionein-1 like protein [Oenanthe javanica] 63 1e-10 AFP49330.1 metallothionein-1-like protein, partial [Olea europaea] 62 1e-10 XP_012075962.1 PREDICTED: metallothionein-like protein type 2 [J... 62 2e-10 CAE12162.1 metallothionein-like protein, partial [Quercus robur] 62 2e-10 OAY57890.1 hypothetical protein MANES_02G133200 [Manihot esculenta] 61 4e-10 OAY57889.1 hypothetical protein MANES_02G133200 [Manihot esculenta] 61 4e-10 AAC62510.1 metallothionein-1-like protein [Spuriopimpinella brac... 61 6e-10 AAY84148.1 metallothionein [Catharanthus roseus] 60 1e-09 XP_012075964.1 PREDICTED: metallothionein-like protein type 2 [J... 60 1e-09 >XP_017249682.1 PREDICTED: metallothionein-like protein type 2 [Daucus carota subsp. sativus] KZM95666.1 hypothetical protein DCAR_018908 [Daucus carota subsp. sativus] Length = 77 Score = 77.0 bits (188), Expect = 3e-16 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -1 Query: 358 MYAEGSEMSFGAEGGHACKCGSNCTCNPCKC 266 MYAEGSEMSFGAEGGHACKCGSNCTCNPCKC Sbjct: 47 MYAEGSEMSFGAEGGHACKCGSNCTCNPCKC 77 >XP_011089462.1 PREDICTED: metallothionein-like protein 1 [Sesamum indicum] Length = 75 Score = 70.1 bits (170), Expect = 1e-13 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = -1 Query: 361 KMYAEGSEMSFGAEGGHACKCGSNCTCNPCKC 266 KMY+EGSE SFGAEGGH CKCGSNCTC+PC C Sbjct: 44 KMYSEGSEKSFGAEGGHGCKCGSNCTCDPCNC 75 >XP_011089466.1 PREDICTED: metallothionein-like protein 1 [Sesamum indicum] Length = 75 Score = 68.2 bits (165), Expect = 8e-13 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = -1 Query: 361 KMYAEGSEMSFGAEGGHACKCGSNCTCNPCKC 266 KMY+EGSE SFGAEGGH CKCGS+CTC+PC C Sbjct: 44 KMYSEGSEKSFGAEGGHGCKCGSSCTCDPCNC 75 >EYU18964.1 hypothetical protein MIMGU_mgv1a017480mg [Erythranthe guttata] Length = 72 Score = 67.0 bits (162), Expect = 2e-12 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = -1 Query: 364 AKMYAEGSEMSFGAEGGHACKCGSNCTCNPCKC 266 +KMYAEGSE SFGAEGG+ CKCGS+CTC+PC C Sbjct: 40 SKMYAEGSEKSFGAEGGNGCKCGSSCTCDPCNC 72 >APX42724.1 MT2b [Hevea brasiliensis] Length = 79 Score = 66.6 bits (161), Expect = 3e-12 Identities = 25/32 (78%), Positives = 27/32 (84%) Frame = -1 Query: 361 KMYAEGSEMSFGAEGGHACKCGSNCTCNPCKC 266 K Y EGSEM+FGAEGGH CKCGSNC C+PC C Sbjct: 47 KFYEEGSEMNFGAEGGHGCKCGSNCNCDPCNC 78 >XP_012827917.1 PREDICTED: metallothionein-like protein 1 [Erythranthe guttata] P20238.1 RecName: Full=Metallothionein-like protein 1; Short=MT-1 EYU18965.1 hypothetical protein MIMGU_mgv1a017478mg [Erythranthe guttata] Length = 72 Score = 65.1 bits (157), Expect = 1e-11 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = -1 Query: 361 KMYAEGSEMSFGAEGGHACKCGSNCTCNPCKC 266 KMY+EGSE SFGAEGG+ CKCGSNC C+PC C Sbjct: 41 KMYSEGSEKSFGAEGGNGCKCGSNCKCDPCNC 72 >CAA36249.1 metallothionein [Erythranthe guttata] Length = 72 Score = 65.1 bits (157), Expect = 1e-11 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = -1 Query: 361 KMYAEGSEMSFGAEGGHACKCGSNCTCNPCKC 266 KMY+EGSE SFGAEGG+ CKCGSNC C+PC C Sbjct: 41 KMYSEGSEKSFGAEGGNGCKCGSNCKCDPCNC 72 >XP_017231083.1 PREDICTED: metallothionein-like protein type 2 [Daucus carota subsp. sativus] Length = 76 Score = 65.1 bits (157), Expect = 1e-11 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = -1 Query: 355 YAEGSEMSFGAEGGHACKCGSNCTCNPCKC 266 +++GSE+ F AEGGHACKCGSNCTCNPCKC Sbjct: 47 FSQGSEVIFAAEGGHACKCGSNCTCNPCKC 76 >XP_017234985.1 PREDICTED: metallothionein-like protein 1 [Daucus carota subsp. sativus] KZN04499.1 hypothetical protein DCAR_005336 [Daucus carota subsp. sativus] Length = 75 Score = 63.2 bits (152), Expect = 7e-11 Identities = 24/32 (75%), Positives = 28/32 (87%) Frame = -1 Query: 361 KMYAEGSEMSFGAEGGHACKCGSNCTCNPCKC 266 K Y +G+E SFGAEGG+ACKCGSNCTC+PC C Sbjct: 44 KSYFDGAEKSFGAEGGNACKCGSNCTCDPCNC 75 >ABD73299.1 metallothionein-like protein [Panax ginseng] Length = 75 Score = 63.2 bits (152), Expect = 7e-11 Identities = 24/33 (72%), Positives = 27/33 (81%) Frame = -1 Query: 364 AKMYAEGSEMSFGAEGGHACKCGSNCTCNPCKC 266 AK Y +G E +FGAEGGHACKCGSNC C+PC C Sbjct: 43 AKTYFDGFERNFGAEGGHACKCGSNCNCDPCNC 75 >KZV06627.1 hypothetical protein F511_45894 [Dorcoceras hygrometricum] Length = 75 Score = 62.8 bits (151), Expect = 1e-10 Identities = 24/32 (75%), Positives = 27/32 (84%) Frame = -1 Query: 361 KMYAEGSEMSFGAEGGHACKCGSNCTCNPCKC 266 KM+ EGSE S GAEGG++CKCG NC CNPCKC Sbjct: 44 KMFFEGSEKSLGAEGGNSCKCGPNCACNPCKC 75 >AAB70560.1 metallothionein-1 like protein [Oenanthe javanica] Length = 76 Score = 62.8 bits (151), Expect = 1e-10 Identities = 24/32 (75%), Positives = 28/32 (87%) Frame = -1 Query: 361 KMYAEGSEMSFGAEGGHACKCGSNCTCNPCKC 266 K +++GS MSF AEGGHACKCGSNCTC+PC C Sbjct: 45 KTFSQGSGMSFVAEGGHACKCGSNCTCDPCNC 76 >AFP49330.1 metallothionein-1-like protein, partial [Olea europaea] Length = 48 Score = 62.0 bits (149), Expect = 1e-10 Identities = 24/32 (75%), Positives = 27/32 (84%) Frame = -1 Query: 361 KMYAEGSEMSFGAEGGHACKCGSNCTCNPCKC 266 KM ++GSE S AEGGHACKCGSNCTC+PC C Sbjct: 17 KMQSDGSEKSSSAEGGHACKCGSNCTCDPCNC 48 >XP_012075962.1 PREDICTED: metallothionein-like protein type 2 [Jatropha curcas] Length = 77 Score = 62.0 bits (149), Expect = 2e-10 Identities = 24/33 (72%), Positives = 26/33 (78%) Frame = -1 Query: 364 AKMYAEGSEMSFGAEGGHACKCGSNCTCNPCKC 266 +K E SEMSFGAEGGH CKCGSNC C+PC C Sbjct: 45 SKKLNESSEMSFGAEGGHGCKCGSNCNCDPCNC 77 >CAE12162.1 metallothionein-like protein, partial [Quercus robur] Length = 98 Score = 62.4 bits (150), Expect = 2e-10 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = -1 Query: 364 AKMYAEGSEMSFGAEGGHACKCGSNCTCNPCKC 266 AK+Y+EGSEMSFGAE G CKCGSNCTC+PC C Sbjct: 66 AKIYSEGSEMSFGAENG-GCKCGSNCTCDPCNC 97 >OAY57890.1 hypothetical protein MANES_02G133200 [Manihot esculenta] Length = 71 Score = 61.2 bits (147), Expect = 4e-10 Identities = 23/33 (69%), Positives = 26/33 (78%) Frame = -1 Query: 364 AKMYAEGSEMSFGAEGGHACKCGSNCTCNPCKC 266 AK + EGSEM+ GAE GH CKCGSNC C+PC C Sbjct: 38 AKKFNEGSEMNLGAESGHGCKCGSNCNCDPCNC 70 >OAY57889.1 hypothetical protein MANES_02G133200 [Manihot esculenta] Length = 78 Score = 61.2 bits (147), Expect = 4e-10 Identities = 23/33 (69%), Positives = 26/33 (78%) Frame = -1 Query: 364 AKMYAEGSEMSFGAEGGHACKCGSNCTCNPCKC 266 AK + EGSEM+ GAE GH CKCGSNC C+PC C Sbjct: 45 AKKFNEGSEMNLGAESGHGCKCGSNCNCDPCNC 77 >AAC62510.1 metallothionein-1-like protein [Spuriopimpinella brachycarpa] Length = 76 Score = 60.8 bits (146), Expect = 6e-10 Identities = 23/32 (71%), Positives = 27/32 (84%) Frame = -1 Query: 361 KMYAEGSEMSFGAEGGHACKCGSNCTCNPCKC 266 K +++GSEMS AEGGH CKCGSNCTC+PC C Sbjct: 45 KTFSQGSEMSSVAEGGHTCKCGSNCTCDPCNC 76 >AAY84148.1 metallothionein [Catharanthus roseus] Length = 73 Score = 60.1 bits (144), Expect = 1e-09 Identities = 24/32 (75%), Positives = 25/32 (78%) Frame = -1 Query: 361 KMYAEGSEMSFGAEGGHACKCGSNCTCNPCKC 266 KM E SE SFGAEGGH CKCGSNC C+PC C Sbjct: 42 KMDFEESEKSFGAEGGHGCKCGSNCNCDPCNC 73 >XP_012075964.1 PREDICTED: metallothionein-like protein type 2 [Jatropha curcas] ACS96440.1 metallothionein-like protein [Jatropha curcas] KDP34499.1 hypothetical protein JCGZ_11049 [Jatropha curcas] Length = 77 Score = 60.1 bits (144), Expect = 1e-09 Identities = 23/33 (69%), Positives = 26/33 (78%) Frame = -1 Query: 364 AKMYAEGSEMSFGAEGGHACKCGSNCTCNPCKC 266 +K E SEMS GAEGGH CKCGSNC+C+PC C Sbjct: 45 SKKLNESSEMSIGAEGGHGCKCGSNCSCDPCNC 77