BLASTX nr result
ID: Glycyrrhiza29_contig00040198
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza29_contig00040198 (269 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_012569751.1 PREDICTED: piriformospora indica-insensitive prot... 56 3e-07 >XP_012569751.1 PREDICTED: piriformospora indica-insensitive protein 2, partial [Cicer arietinum] Length = 435 Score = 56.2 bits (134), Expect = 3e-07 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +2 Query: 2 ENGGSLGGQLVKPCKIPDVYPDAVLFNGVSLDPFDPLTLVLVTSL 136 ENGG LG + PCKI DV PDAV+FNGVSL FDPLTLVLV+ L Sbjct: 388 ENGGRLGQ--INPCKITDV-PDAVVFNGVSLLLFDPLTLVLVSLL 429