BLASTX nr result
ID: Glycyrrhiza29_contig00040193
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza29_contig00040193 (233 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_003596557.1 terpene synthase family, metal-binding domain pro... 55 5e-07 BAT92460.1 hypothetical protein VIGAN_07118800, partial [Vigna a... 51 7e-07 XP_012572573.1 PREDICTED: probable terpene synthase 2 isoform X1... 54 9e-07 XP_003596565.1 sesquiterpene synthase, putative [Medicago trunca... 54 1e-06 XP_013454913.1 terpene synthase family, metal-binding domain pro... 54 1e-06 XP_016169327.1 PREDICTED: probable terpene synthase 2 [Arachis i... 53 2e-06 >XP_003596557.1 terpene synthase family, metal-binding domain protein [Medicago truncatula] ABN09069.1 Terpene synthase-like; Terpenoid synthase [Medicago truncatula] AES66808.1 terpene synthase family, metal-binding domain protein [Medicago truncatula] Length = 561 Score = 55.1 bits (131), Expect = 5e-07 Identities = 23/29 (79%), Positives = 25/29 (86%) Frame = +2 Query: 131 PAPPDFKRPCVNFRPSIWGDVFLQYDSEP 217 PAP D KRP V+F PSIWGDVFLQYDS+P Sbjct: 7 PAPVDIKRPIVDFSPSIWGDVFLQYDSQP 35 >BAT92460.1 hypothetical protein VIGAN_07118800, partial [Vigna angularis var. angularis] Length = 72 Score = 51.2 bits (121), Expect = 7e-07 Identities = 28/44 (63%), Positives = 29/44 (65%) Frame = +2 Query: 83 K*ITMSLTAPTTSTQHPAPPDFKRPCVNFRPSIWGDVFLQYDSE 214 K ITMSL ST+H AP RPC NF PS WGD FLQYDSE Sbjct: 12 KKITMSL-----STEH-APSAITRPCANFPPSFWGDSFLQYDSE 49 >XP_012572573.1 PREDICTED: probable terpene synthase 2 isoform X1 [Cicer arietinum] XP_012572575.1 PREDICTED: probable terpene synthase 2 isoform X2 [Cicer arietinum] XP_012572576.1 PREDICTED: probable terpene synthase 2 isoform X3 [Cicer arietinum] Length = 553 Score = 54.3 bits (129), Expect = 9e-07 Identities = 28/42 (66%), Positives = 29/42 (69%) Frame = +2 Query: 95 MSLTAPTTSTQHPAPPDFKRPCVNFRPSIWGDVFLQYDSEPP 220 MSL PT A PD RP VNFRPSIWGDVFLQYDS+ P Sbjct: 1 MSLAPPTH-----AVPDNTRPRVNFRPSIWGDVFLQYDSQSP 37 >XP_003596565.1 sesquiterpene synthase, putative [Medicago truncatula] AES66816.1 sesquiterpene synthase, putative [Medicago truncatula] Length = 557 Score = 53.9 bits (128), Expect = 1e-06 Identities = 29/42 (69%), Positives = 32/42 (76%), Gaps = 2/42 (4%) Frame = +2 Query: 95 MSLTAPTT--STQHPAPPDFKRPCVNFRPSIWGDVFLQYDSE 214 MSL T+ ST+H A PDFKRP VNF PSIW +VFLQYDSE Sbjct: 1 MSLAPATSVDSTEH-AIPDFKRPIVNFSPSIWRNVFLQYDSE 41 >XP_013454913.1 terpene synthase family, metal-binding domain protein [Medicago truncatula] KEH28961.1 terpene synthase family, metal-binding domain protein [Medicago truncatula] Length = 558 Score = 53.9 bits (128), Expect = 1e-06 Identities = 26/42 (61%), Positives = 31/42 (73%), Gaps = 2/42 (4%) Frame = +2 Query: 95 MSLTAPTT--STQHPAPPDFKRPCVNFRPSIWGDVFLQYDSE 214 MSL AP+ STQH P D +RP +NF PS+WG +FLQYDSE Sbjct: 1 MSLAAPSPVDSTQHTVP-DIRRPNINFSPSVWGHIFLQYDSE 41 >XP_016169327.1 PREDICTED: probable terpene synthase 2 [Arachis ipaensis] Length = 563 Score = 53.1 bits (126), Expect = 2e-06 Identities = 25/43 (58%), Positives = 29/43 (67%) Frame = +2 Query: 95 MSLTAPTTSTQHPAPPDFKRPCVNFRPSIWGDVFLQYDSEPPV 223 MSL A T QH + D RPC NFRPSIWGD+FLQY + P+ Sbjct: 1 MSLAAATNDDQHLSY-DITRPCANFRPSIWGDLFLQYHNSHPL 42