BLASTX nr result
ID: Glycyrrhiza29_contig00040060
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza29_contig00040060 (208 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_013458165.1 zinc finger, C3HC4 type (RING finger) protein [Me... 55 3e-07 >XP_013458165.1 zinc finger, C3HC4 type (RING finger) protein [Medicago truncatula] KEH32196.1 zinc finger, C3HC4 type (RING finger) protein [Medicago truncatula] Length = 358 Score = 55.1 bits (131), Expect = 3e-07 Identities = 30/60 (50%), Positives = 36/60 (60%), Gaps = 9/60 (15%) Frame = +3 Query: 54 YSSNGYTAATPNSMMPGRPNHPFYPGPGQGQPDVR---------PPPYVDHQTAKKIRND 206 Y SNGYT A NSM+P +P+HPFY D+ PPPY DH+TAKK+RND Sbjct: 62 YYSNGYTPA--NSMLP-QPHHPFYATTNTQPLDIDVNVVQALPPPPPYTDHETAKKVRND 118