BLASTX nr result
ID: Glycyrrhiza29_contig00039190
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza29_contig00039190 (273 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_019435728.1 PREDICTED: pentatricopeptide repeat-containing pr... 60 1e-08 XP_016165888.1 PREDICTED: pentatricopeptide repeat-containing pr... 55 6e-07 >XP_019435728.1 PREDICTED: pentatricopeptide repeat-containing protein At1g08070, chloroplastic-like [Lupinus angustifolius] Length = 677 Score = 60.5 bits (145), Expect = 1e-08 Identities = 35/67 (52%), Positives = 41/67 (61%) Frame = +3 Query: 66 NPTLENHSKTKTXXXXXXXXXXLHALYLKSGTLNHPQVSSRLLSLYTQKTKTNPNYLHHA 245 NP N KT LHALYLK+GT NHP +SSRLLSLYT N N LH+A Sbjct: 13 NPNFSNFIKTPKQEPHQ-----LHALYLKNGTFNHPSLSSRLLSLYTH---PNINDLHYA 64 Query: 246 RSLFDSM 266 RSLF+++ Sbjct: 65 RSLFNTI 71 >XP_016165888.1 PREDICTED: pentatricopeptide repeat-containing protein At1g08070, chloroplastic-like [Arachis ipaensis] Length = 681 Score = 55.5 bits (132), Expect = 6e-07 Identities = 30/46 (65%), Positives = 34/46 (73%) Frame = +3 Query: 135 HALYLKSGTLNHPQVSSRLLSLYTQKTKTNPNYLHHARSLFDSMQR 272 HALYLKSGTLNHP +SSRLLSLYT N L A SLFD++Q+ Sbjct: 34 HALYLKSGTLNHPSLSSRLLSLYTD---PKINDLKSALSLFDALQQ 76