BLASTX nr result
ID: Glycyrrhiza29_contig00039182
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza29_contig00039182 (271 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU11680.1 hypothetical protein TSUD_74300 [Trifolium subterraneum] 56 3e-07 XP_003630770.2 cyclin-dependent kinase [Medicago truncatula] AET... 56 3e-07 XP_004503449.1 PREDICTED: cyclin-dependent kinase F-1-like [Cice... 52 7e-06 >GAU11680.1 hypothetical protein TSUD_74300 [Trifolium subterraneum] Length = 456 Score = 56.2 bits (134), Expect = 3e-07 Identities = 25/35 (71%), Positives = 31/35 (88%) Frame = +1 Query: 166 DSDAVLILEYLAADLATVIANAAKDGLPLTVGEMK 270 D DAV++LEYL DL+TVI+NAAK+G+PL VGEMK Sbjct: 86 DEDAVIVLEYLTTDLSTVISNAAKEGIPLPVGEMK 120 >XP_003630770.2 cyclin-dependent kinase [Medicago truncatula] AET05246.2 cyclin-dependent kinase [Medicago truncatula] Length = 474 Score = 56.2 bits (134), Expect = 3e-07 Identities = 25/35 (71%), Positives = 31/35 (88%) Frame = +1 Query: 166 DSDAVLILEYLAADLATVIANAAKDGLPLTVGEMK 270 D DAVL+LEYL DLATVI+NAAK+G+P+ VGE+K Sbjct: 86 DEDAVLVLEYLTTDLATVISNAAKEGIPIPVGELK 120 >XP_004503449.1 PREDICTED: cyclin-dependent kinase F-1-like [Cicer arietinum] Length = 474 Score = 52.4 bits (124), Expect = 7e-06 Identities = 25/35 (71%), Positives = 29/35 (82%) Frame = +1 Query: 166 DSDAVLILEYLAADLATVIANAAKDGLPLTVGEMK 270 D DAVL+LEYL DL TVI++AAK+GL L VGEMK Sbjct: 86 DEDAVLVLEYLTTDLTTVISDAAKEGLSLPVGEMK 120