BLASTX nr result
ID: Glycyrrhiza29_contig00039148
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza29_contig00039148 (200 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KRH39238.1 hypothetical protein GLYMA_09G187400 [Glycine max] 90 2e-19 KHN32014.1 Gastric triacylglycerol lipase [Glycine soja] 90 2e-19 XP_003534180.1 PREDICTED: uncharacterized protein LOC100785917 [... 90 2e-19 KHN20710.1 Gastric triacylglycerol lipase [Glycine soja] 86 6e-18 XP_003528915.1 PREDICTED: uncharacterized protein LOC100785512 [... 86 6e-18 XP_007152796.1 hypothetical protein PHAVU_004G160400g [Phaseolus... 81 2e-16 XP_004503422.1 PREDICTED: uncharacterized protein LOC101491052 [... 81 3e-16 XP_017440384.1 PREDICTED: uncharacterized protein LOC108345993 [... 79 1e-15 XP_014513935.1 PREDICTED: uncharacterized protein LOC106772205 [... 79 1e-15 KOM54294.1 hypothetical protein LR48_Vigan10g018600 [Vigna angul... 79 1e-15 GAU39277.1 hypothetical protein TSUD_72160 [Trifolium subterraneum] 78 3e-15 XP_013453046.1 alpha/beta hydrolase family protein [Medicago tru... 75 2e-14 ACJ85656.1 unknown, partial [Medicago truncatula] 75 2e-14 XP_013453045.1 alpha/beta hydrolase family protein [Medicago tru... 75 2e-14 XP_015966705.1 PREDICTED: lipase member M-like isoform X2 [Arach... 75 3e-14 XP_015966704.1 PREDICTED: uncharacterized protein LOC107490436 i... 75 3e-14 KYP42672.1 Gastric triacylglycerol lipase [Cajanus cajan] 74 1e-13 XP_016203660.1 PREDICTED: lipase member M-like isoform X2 [Arach... 73 1e-13 XP_019458656.1 PREDICTED: lipase member M-like isoform X2 [Lupin... 73 1e-13 XP_019458655.1 PREDICTED: uncharacterized protein LOC109358709 i... 73 1e-13 >KRH39238.1 hypothetical protein GLYMA_09G187400 [Glycine max] Length = 627 Score = 89.7 bits (221), Expect = 2e-19 Identities = 43/60 (71%), Positives = 49/60 (81%) Frame = -1 Query: 200 ESVFDVVHKAAHLLLSPSEAFGALFRLFSSHKSGIKEHCNGVEDASTSTATPEGKDPTPS 21 E+VFDVVHKAAHLL+SPSEAFG LFRLFSSH+SG KE C+GVED +AT DPTP+ Sbjct: 146 EAVFDVVHKAAHLLISPSEAFGTLFRLFSSHESGTKEDCDGVEDTPIYSATLGENDPTPT 205 >KHN32014.1 Gastric triacylglycerol lipase [Glycine soja] Length = 697 Score = 89.7 bits (221), Expect = 2e-19 Identities = 43/60 (71%), Positives = 49/60 (81%) Frame = -1 Query: 200 ESVFDVVHKAAHLLLSPSEAFGALFRLFSSHKSGIKEHCNGVEDASTSTATPEGKDPTPS 21 E+VFDVVHKAAHLL+SPSEAFG LFRLFSSH+SG KE C+GVED +AT DPTP+ Sbjct: 216 EAVFDVVHKAAHLLISPSEAFGTLFRLFSSHESGTKEDCDGVEDTPIYSATLGENDPTPT 275 >XP_003534180.1 PREDICTED: uncharacterized protein LOC100785917 [Glycine max] KRH39237.1 hypothetical protein GLYMA_09G187400 [Glycine max] Length = 697 Score = 89.7 bits (221), Expect = 2e-19 Identities = 43/60 (71%), Positives = 49/60 (81%) Frame = -1 Query: 200 ESVFDVVHKAAHLLLSPSEAFGALFRLFSSHKSGIKEHCNGVEDASTSTATPEGKDPTPS 21 E+VFDVVHKAAHLL+SPSEAFG LFRLFSSH+SG KE C+GVED +AT DPTP+ Sbjct: 216 EAVFDVVHKAAHLLISPSEAFGTLFRLFSSHESGTKEDCDGVEDTPIYSATLGENDPTPT 275 >KHN20710.1 Gastric triacylglycerol lipase [Glycine soja] Length = 697 Score = 85.5 bits (210), Expect = 6e-18 Identities = 42/60 (70%), Positives = 46/60 (76%) Frame = -1 Query: 200 ESVFDVVHKAAHLLLSPSEAFGALFRLFSSHKSGIKEHCNGVEDASTSTATPEGKDPTPS 21 E+VFDVVHKAAHLL SPSEAFG LFRLFSSH+S KE C+GVED TAT DP P+ Sbjct: 216 EAVFDVVHKAAHLLFSPSEAFGTLFRLFSSHESDTKEDCDGVEDTPIYTATLGENDPMPT 275 >XP_003528915.1 PREDICTED: uncharacterized protein LOC100785512 [Glycine max] KRH48452.1 hypothetical protein GLYMA_07G089400 [Glycine max] Length = 701 Score = 85.5 bits (210), Expect = 6e-18 Identities = 42/60 (70%), Positives = 46/60 (76%) Frame = -1 Query: 200 ESVFDVVHKAAHLLLSPSEAFGALFRLFSSHKSGIKEHCNGVEDASTSTATPEGKDPTPS 21 E+VFDVVHKAAHLL SPSEAFG LFRLFSSH+S KE C+GVED TAT DP P+ Sbjct: 220 EAVFDVVHKAAHLLFSPSEAFGTLFRLFSSHESDTKEDCDGVEDTPIYTATLGENDPMPT 279 >XP_007152796.1 hypothetical protein PHAVU_004G160400g [Phaseolus vulgaris] ESW24790.1 hypothetical protein PHAVU_004G160400g [Phaseolus vulgaris] Length = 701 Score = 81.3 bits (199), Expect = 2e-16 Identities = 41/60 (68%), Positives = 46/60 (76%) Frame = -1 Query: 200 ESVFDVVHKAAHLLLSPSEAFGALFRLFSSHKSGIKEHCNGVEDASTSTATPEGKDPTPS 21 E+VFDV HKAAHLLLSPSEAFGALFRLFS+H+S IKE +GVED S T DP P+ Sbjct: 220 EAVFDVFHKAAHLLLSPSEAFGALFRLFSAHESAIKEDHDGVEDVSVYKETLGENDPIPT 279 >XP_004503422.1 PREDICTED: uncharacterized protein LOC101491052 [Cicer arietinum] Length = 697 Score = 80.9 bits (198), Expect = 3e-16 Identities = 39/65 (60%), Positives = 49/65 (75%) Frame = -1 Query: 200 ESVFDVVHKAAHLLLSPSEAFGALFRLFSSHKSGIKEHCNGVEDASTSTATPEGKDPTPS 21 E+VFD+VHKA HLLLSPSEAFG LF LFSSH+ ++E NGV++A+ TAT DPTP+ Sbjct: 215 EAVFDIVHKAVHLLLSPSEAFGKLFSLFSSHERCVEEDDNGVQNATVFTATLGENDPTPT 274 Query: 20 PSESN 6 +N Sbjct: 275 DRNTN 279 >XP_017440384.1 PREDICTED: uncharacterized protein LOC108345993 [Vigna angularis] BAU02825.1 hypothetical protein VIGAN_11241300 [Vigna angularis var. angularis] Length = 701 Score = 79.0 bits (193), Expect = 1e-15 Identities = 41/59 (69%), Positives = 45/59 (76%) Frame = -1 Query: 200 ESVFDVVHKAAHLLLSPSEAFGALFRLFSSHKSGIKEHCNGVEDASTSTATPEGKDPTP 24 E+VFDVVHKAAHLLLSPSEAFGAL RLFSSH+S +K +G EDAS T T DP P Sbjct: 220 EAVFDVVHKAAHLLLSPSEAFGALVRLFSSHESAVKGDPDGEEDASIYTDTLGENDPKP 278 >XP_014513935.1 PREDICTED: uncharacterized protein LOC106772205 [Vigna radiata var. radiata] Length = 701 Score = 79.0 bits (193), Expect = 1e-15 Identities = 41/59 (69%), Positives = 45/59 (76%) Frame = -1 Query: 200 ESVFDVVHKAAHLLLSPSEAFGALFRLFSSHKSGIKEHCNGVEDASTSTATPEGKDPTP 24 E+VFDVVHKAAHLLLSPSEAFGAL RLFSSH+S +K +G EDAS T T DP P Sbjct: 220 EAVFDVVHKAAHLLLSPSEAFGALVRLFSSHESAVKGDHDGEEDASIYTDTLGENDPKP 278 >KOM54294.1 hypothetical protein LR48_Vigan10g018600 [Vigna angularis] Length = 900 Score = 79.0 bits (193), Expect = 1e-15 Identities = 41/59 (69%), Positives = 45/59 (76%) Frame = -1 Query: 200 ESVFDVVHKAAHLLLSPSEAFGALFRLFSSHKSGIKEHCNGVEDASTSTATPEGKDPTP 24 E+VFDVVHKAAHLLLSPSEAFGAL RLFSSH+S +K +G EDAS T T DP P Sbjct: 189 EAVFDVVHKAAHLLLSPSEAFGALVRLFSSHESAVKGDPDGEEDASIYTDTLGENDPKP 247 >GAU39277.1 hypothetical protein TSUD_72160 [Trifolium subterraneum] Length = 699 Score = 77.8 bits (190), Expect = 3e-15 Identities = 39/60 (65%), Positives = 47/60 (78%) Frame = -1 Query: 200 ESVFDVVHKAAHLLLSPSEAFGALFRLFSSHKSGIKEHCNGVEDASTSTATPEGKDPTPS 21 E+VFD VHKA +LLLSPSEAFG LFRLFSSH+ GI++ N VE+A+ TAT DPTP+ Sbjct: 217 EAVFDFVHKAVYLLLSPSEAFGKLFRLFSSHERGIEDDDNVVENATVYTATLGENDPTPT 276 >XP_013453046.1 alpha/beta hydrolase family protein [Medicago truncatula] KEH27074.1 alpha/beta hydrolase family protein [Medicago truncatula] Length = 566 Score = 75.5 bits (184), Expect = 2e-14 Identities = 41/65 (63%), Positives = 49/65 (75%) Frame = -1 Query: 200 ESVFDVVHKAAHLLLSPSEAFGALFRLFSSHKSGIKEHCNGVEDASTSTATPEGKDPTPS 21 E+VFDVVHKAAHL+LSPS+AFGAL LFSS+++GIKE N V DAS S AT G+ P S Sbjct: 85 EAVFDVVHKAAHLVLSPSKAFGALCGLFSSNENGIKEIRNPVVDASVSAATLGGEGPGSS 144 Query: 20 PSESN 6 + N Sbjct: 145 ERKIN 149 >ACJ85656.1 unknown, partial [Medicago truncatula] Length = 606 Score = 75.5 bits (184), Expect = 2e-14 Identities = 41/65 (63%), Positives = 49/65 (75%) Frame = -1 Query: 200 ESVFDVVHKAAHLLLSPSEAFGALFRLFSSHKSGIKEHCNGVEDASTSTATPEGKDPTPS 21 E+VFDVVHKAAHL+LSPS+AFGAL LFSS+++GIKE N V DAS S AT G+ P S Sbjct: 217 EAVFDVVHKAAHLVLSPSKAFGALCGLFSSNENGIKEIRNPVVDASVSAATLGGEGPGSS 276 Query: 20 PSESN 6 + N Sbjct: 277 ERKIN 281 >XP_013453045.1 alpha/beta hydrolase family protein [Medicago truncatula] KEH27073.1 alpha/beta hydrolase family protein [Medicago truncatula] Length = 698 Score = 75.5 bits (184), Expect = 2e-14 Identities = 41/65 (63%), Positives = 49/65 (75%) Frame = -1 Query: 200 ESVFDVVHKAAHLLLSPSEAFGALFRLFSSHKSGIKEHCNGVEDASTSTATPEGKDPTPS 21 E+VFDVVHKAAHL+LSPS+AFGAL LFSS+++GIKE N V DAS S AT G+ P S Sbjct: 217 EAVFDVVHKAAHLVLSPSKAFGALCGLFSSNENGIKEIRNPVVDASVSAATLGGEGPGSS 276 Query: 20 PSESN 6 + N Sbjct: 277 ERKIN 281 >XP_015966705.1 PREDICTED: lipase member M-like isoform X2 [Arachis duranensis] Length = 643 Score = 75.1 bits (183), Expect = 3e-14 Identities = 38/65 (58%), Positives = 47/65 (72%) Frame = -1 Query: 200 ESVFDVVHKAAHLLLSPSEAFGALFRLFSSHKSGIKEHCNGVEDASTSTATPEGKDPTPS 21 E+VFD HKAAHLLLSPSEAF A+ LFSSH SGI++ + +DA+ STAT G DP P+ Sbjct: 163 EAVFDFFHKAAHLLLSPSEAFVAIVSLFSSHGSGIEQDHDTFKDAAISTATRGGDDPAPT 222 Query: 20 PSESN 6 +N Sbjct: 223 ERSTN 227 >XP_015966704.1 PREDICTED: uncharacterized protein LOC107490436 isoform X1 [Arachis duranensis] Length = 690 Score = 75.1 bits (183), Expect = 3e-14 Identities = 38/65 (58%), Positives = 47/65 (72%) Frame = -1 Query: 200 ESVFDVVHKAAHLLLSPSEAFGALFRLFSSHKSGIKEHCNGVEDASTSTATPEGKDPTPS 21 E+VFD HKAAHLLLSPSEAF A+ LFSSH SGI++ + +DA+ STAT G DP P+ Sbjct: 210 EAVFDFFHKAAHLLLSPSEAFVAIVSLFSSHGSGIEQDHDTFKDAAISTATRGGDDPAPT 269 Query: 20 PSESN 6 +N Sbjct: 270 ERSTN 274 >KYP42672.1 Gastric triacylglycerol lipase [Cajanus cajan] Length = 702 Score = 73.6 bits (179), Expect = 1e-13 Identities = 41/61 (67%), Positives = 45/61 (73%), Gaps = 1/61 (1%) Frame = -1 Query: 200 ESVFDVVHKAAHLLLSPSEAFGALFRLFSSHK-SGIKEHCNGVEDASTSTATPEGKDPTP 24 E+VFDVVHKAAHLLLSPSEAFG LFRLFSSH+ S KE + VED S TAT D P Sbjct: 220 EAVFDVVHKAAHLLLSPSEAFGKLFRLFSSHEGSSSKEDRDSVEDTSVYTATLGENDLKP 279 Query: 23 S 21 + Sbjct: 280 T 280 >XP_016203660.1 PREDICTED: lipase member M-like isoform X2 [Arachis ipaensis] Length = 643 Score = 73.2 bits (178), Expect = 1e-13 Identities = 38/65 (58%), Positives = 46/65 (70%) Frame = -1 Query: 200 ESVFDVVHKAAHLLLSPSEAFGALFRLFSSHKSGIKEHCNGVEDASTSTATPEGKDPTPS 21 E+VFD HKAAHLLLSPSEAF AL LFSSH SGI++ + +DA+ STAT G P P+ Sbjct: 163 EAVFDFFHKAAHLLLSPSEAFVALVSLFSSHGSGIEQDHDPFKDAAISTATRGGDGPAPT 222 Query: 20 PSESN 6 +N Sbjct: 223 ERSTN 227 >XP_019458656.1 PREDICTED: lipase member M-like isoform X2 [Lupinus angustifolius] Length = 664 Score = 73.2 bits (178), Expect = 1e-13 Identities = 37/65 (56%), Positives = 46/65 (70%) Frame = -1 Query: 200 ESVFDVVHKAAHLLLSPSEAFGALFRLFSSHKSGIKEHCNGVEDASTSTATPEGKDPTPS 21 E+VFDVV KAAHLLLSPS+AF L RLFS ++SGIKE ++D S+ATP D TP+ Sbjct: 188 EAVFDVVRKAAHLLLSPSKAFRTLLRLFSFNESGIKEDHGDIDDTFVSSATPGENDQTPT 247 Query: 20 PSESN 6 +N Sbjct: 248 ERNTN 252 >XP_019458655.1 PREDICTED: uncharacterized protein LOC109358709 isoform X1 [Lupinus angustifolius] OIW03656.1 hypothetical protein TanjilG_22313 [Lupinus angustifolius] Length = 687 Score = 73.2 bits (178), Expect = 1e-13 Identities = 37/65 (56%), Positives = 46/65 (70%) Frame = -1 Query: 200 ESVFDVVHKAAHLLLSPSEAFGALFRLFSSHKSGIKEHCNGVEDASTSTATPEGKDPTPS 21 E+VFDVV KAAHLLLSPS+AF L RLFS ++SGIKE ++D S+ATP D TP+ Sbjct: 211 EAVFDVVRKAAHLLLSPSKAFRTLLRLFSFNESGIKEDHGDIDDTFVSSATPGENDQTPT 270 Query: 20 PSESN 6 +N Sbjct: 271 ERNTN 275