BLASTX nr result
ID: Glycyrrhiza29_contig00039119
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza29_contig00039119 (305 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU19203.1 hypothetical protein TSUD_198860 [Trifolium subterran... 62 6e-10 XP_002489092.1 hypothetical protein SORBIDRAFT_0088s002240, part... 50 5e-06 >GAU19203.1 hypothetical protein TSUD_198860 [Trifolium subterraneum] Length = 172 Score = 62.4 bits (150), Expect = 6e-10 Identities = 43/100 (43%), Positives = 45/100 (45%), Gaps = 3/100 (3%) Frame = -2 Query: 292 FQAYLDIGNQPASCW---PYRIIISGDVHGRRSQ*VLINVKGAQRG*GGGPVCFCEKSSA 122 FQAYLDIGNQPASCW PYRIIISGDV R Sbjct: 39 FQAYLDIGNQPASCWPGRPYRIIISGDVRTR----------------------------- 69 Query: 121 PVIAEKKT*YLYLMSIHPYFHSF*REANCLPAGSCMSGNV 2 EK+ REA+CLPAGSCMSGNV Sbjct: 70 ----EKEP----------------READCLPAGSCMSGNV 89 >XP_002489092.1 hypothetical protein SORBIDRAFT_0088s002240, partial [Sorghum bicolor] Length = 58 Score = 49.7 bits (117), Expect = 5e-06 Identities = 23/31 (74%), Positives = 26/31 (83%) Frame = +2 Query: 2 DVTAHTATSRQAVSLPLKRMEVWMNRHQIQV 94 DVTAHTA S+QAVS PL+ MEVW+NRHQ V Sbjct: 17 DVTAHTAPSQQAVSFPLEVMEVWINRHQTLV 47