BLASTX nr result
ID: Glycyrrhiza29_contig00038949
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza29_contig00038949 (230 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU34282.1 hypothetical protein TSUD_321280 [Trifolium subterran... 89 1e-19 XP_016182132.1 PREDICTED: putative clathrin assembly protein At4... 89 2e-19 XP_015944021.1 PREDICTED: putative clathrin assembly protein At4... 89 2e-19 XP_004502396.1 PREDICTED: putative clathrin assembly protein At4... 89 3e-19 XP_017429385.1 PREDICTED: putative clathrin assembly protein At4... 88 5e-19 XP_014507445.1 PREDICTED: putative clathrin assembly protein At4... 88 5e-19 XP_003537559.1 PREDICTED: putative clathrin assembly protein At4... 87 6e-19 XP_003601907.1 clathrin assembly protein [Medicago truncatula] A... 87 7e-19 KOM30747.1 hypothetical protein LR48_Vigan01g030200 [Vigna angul... 88 1e-18 XP_003524256.1 PREDICTED: putative clathrin assembly protein At4... 86 2e-18 XP_019462677.1 PREDICTED: putative clathrin assembly protein At4... 86 3e-18 XP_003552807.1 PREDICTED: putative clathrin assembly protein At4... 84 1e-17 XP_007159704.1 hypothetical protein PHAVU_002G260200g [Phaseolus... 84 1e-17 KRH43124.1 hypothetical protein GLYMA_08G132400 [Glycine max] 84 2e-17 KYP32521.1 Putative clathrin assembly protein At4g40080 family [... 82 1e-16 XP_013446750.1 clathrin assembly protein [Medicago truncatula] K... 81 2e-16 ACJ85393.1 unknown [Medicago truncatula] AFK47421.1 unknown [Med... 81 2e-16 GAU19147.1 hypothetical protein TSUD_79700 [Trifolium subterraneum] 80 5e-16 XP_014493489.1 PREDICTED: putative clathrin assembly protein At4... 79 1e-15 XP_017416838.1 PREDICTED: putative clathrin assembly protein At4... 79 1e-15 >GAU34282.1 hypothetical protein TSUD_321280 [Trifolium subterraneum] Length = 333 Score = 89.4 bits (220), Expect = 1e-19 Identities = 44/63 (69%), Positives = 49/63 (77%) Frame = +1 Query: 40 MRKLKEVMDVMKDKASQGKAVILSNQTNLSLLRATTHDYSTPPSHKHLSALLSSGDGPRA 219 M+KLKE++ +KDKASQ KA I S LSLLRATTHD TPP HKH+S LLSSGDG RA Sbjct: 1 MKKLKEIIGKLKDKASQSKAAIFSKHKTLSLLRATTHDSFTPPKHKHISTLLSSGDGSRA 60 Query: 220 TAS 228 TAS Sbjct: 61 TAS 63 >XP_016182132.1 PREDICTED: putative clathrin assembly protein At4g40080 [Arachis ipaensis] Length = 349 Score = 89.4 bits (220), Expect = 2e-19 Identities = 43/63 (68%), Positives = 53/63 (84%) Frame = +1 Query: 40 MRKLKEVMDVMKDKASQGKAVILSNQTNLSLLRATTHDYSTPPSHKHLSALLSSGDGPRA 219 M KL+E++ ++KDKASQ KA ILSN+ NLSLLRAT+HD STPP+H LS LLSS DGPR+ Sbjct: 1 MTKLREIIGIIKDKASQSKAAILSNRANLSLLRATSHDPSTPPAHHKLSTLLSSADGPRS 60 Query: 220 TAS 228 +AS Sbjct: 61 SAS 63 >XP_015944021.1 PREDICTED: putative clathrin assembly protein At4g40080 [Arachis duranensis] Length = 349 Score = 89.4 bits (220), Expect = 2e-19 Identities = 43/63 (68%), Positives = 53/63 (84%) Frame = +1 Query: 40 MRKLKEVMDVMKDKASQGKAVILSNQTNLSLLRATTHDYSTPPSHKHLSALLSSGDGPRA 219 M KL+E++ ++KDKASQ KA ILSN+ NLSLLRAT+HD STPP+H LS LLSS DGPR+ Sbjct: 1 MTKLREIIGIIKDKASQSKAAILSNRANLSLLRATSHDPSTPPAHHKLSTLLSSADGPRS 60 Query: 220 TAS 228 +AS Sbjct: 61 SAS 63 >XP_004502396.1 PREDICTED: putative clathrin assembly protein At4g40080 [Cicer arietinum] Length = 331 Score = 88.6 bits (218), Expect = 3e-19 Identities = 43/63 (68%), Positives = 52/63 (82%) Frame = +1 Query: 40 MRKLKEVMDVMKDKASQGKAVILSNQTNLSLLRATTHDYSTPPSHKHLSALLSSGDGPRA 219 M+KLKEV++++KDKASQ KA ILS + LSLLRATTHD PP+HKHL+ LL +GDG RA Sbjct: 1 MKKLKEVINIVKDKASQSKAAILSKRKTLSLLRATTHDSFNPPTHKHLTTLLFTGDGSRA 60 Query: 220 TAS 228 TAS Sbjct: 61 TAS 63 >XP_017429385.1 PREDICTED: putative clathrin assembly protein At4g40080 [Vigna angularis] BAT73425.1 hypothetical protein VIGAN_01090600 [Vigna angularis var. angularis] Length = 326 Score = 87.8 bits (216), Expect = 5e-19 Identities = 43/63 (68%), Positives = 52/63 (82%) Frame = +1 Query: 40 MRKLKEVMDVMKDKASQGKAVILSNQTNLSLLRATTHDYSTPPSHKHLSALLSSGDGPRA 219 M KL ++ ++KDKASQ KA +LS +T LSLLRAT+HD STPP+ KHL+ LLSSGDGPRA Sbjct: 1 MTKLTHLIGIIKDKASQSKAALLSKRTTLSLLRATSHDCSTPPTTKHLAMLLSSGDGPRA 60 Query: 220 TAS 228 TAS Sbjct: 61 TAS 63 >XP_014507445.1 PREDICTED: putative clathrin assembly protein At4g40080 [Vigna radiata var. radiata] Length = 326 Score = 87.8 bits (216), Expect = 5e-19 Identities = 43/63 (68%), Positives = 52/63 (82%) Frame = +1 Query: 40 MRKLKEVMDVMKDKASQGKAVILSNQTNLSLLRATTHDYSTPPSHKHLSALLSSGDGPRA 219 M KL ++ ++KDKASQ KA +LS +T LSLLRAT+HD STPP+ KHL+ LLSSGDGPRA Sbjct: 1 MTKLTHLIGIIKDKASQSKAALLSKRTTLSLLRATSHDCSTPPTTKHLAMLLSSGDGPRA 60 Query: 220 TAS 228 TAS Sbjct: 61 TAS 63 >XP_003537559.1 PREDICTED: putative clathrin assembly protein At4g40080 [Glycine max] KRH31341.1 hypothetical protein GLYMA_11G242900 [Glycine max] Length = 314 Score = 87.4 bits (215), Expect = 6e-19 Identities = 44/63 (69%), Positives = 50/63 (79%) Frame = +1 Query: 40 MRKLKEVMDVMKDKASQGKAVILSNQTNLSLLRATTHDYSTPPSHKHLSALLSSGDGPRA 219 M KLKE++ +MKDKASQGKA ILS + LSLLRAT+HD PP+ HLS LLSSGDG RA Sbjct: 1 MTKLKELIGIMKDKASQGKAAILSKRATLSLLRATSHDSFAPPTRDHLSTLLSSGDGSRA 60 Query: 220 TAS 228 TAS Sbjct: 61 TAS 63 >XP_003601907.1 clathrin assembly protein [Medicago truncatula] AES72158.1 clathrin assembly protein [Medicago truncatula] Length = 328 Score = 87.4 bits (215), Expect = 7e-19 Identities = 44/62 (70%), Positives = 48/62 (77%) Frame = +1 Query: 43 RKLKEVMDVMKDKASQGKAVILSNQTNLSLLRATTHDYSTPPSHKHLSALLSSGDGPRAT 222 +KLKE++ +MKDKASQ KA ILS LSLLRATTHD PP HKHL LLSSGDG RAT Sbjct: 3 KKLKEMIGIMKDKASQSKAAILSKTKTLSLLRATTHDSYNPPKHKHLLTLLSSGDGSRAT 62 Query: 223 AS 228 AS Sbjct: 63 AS 64 >KOM30747.1 hypothetical protein LR48_Vigan01g030200 [Vigna angularis] Length = 413 Score = 87.8 bits (216), Expect = 1e-18 Identities = 43/63 (68%), Positives = 52/63 (82%) Frame = +1 Query: 40 MRKLKEVMDVMKDKASQGKAVILSNQTNLSLLRATTHDYSTPPSHKHLSALLSSGDGPRA 219 M KL ++ ++KDKASQ KA +LS +T LSLLRAT+HD STPP+ KHL+ LLSSGDGPRA Sbjct: 1 MTKLTHLIGIIKDKASQSKAALLSKRTTLSLLRATSHDCSTPPTTKHLAMLLSSGDGPRA 60 Query: 220 TAS 228 TAS Sbjct: 61 TAS 63 >XP_003524256.1 PREDICTED: putative clathrin assembly protein At4g40080 [Glycine max] KRH59275.1 hypothetical protein GLYMA_05G175100 [Glycine max] Length = 319 Score = 85.9 bits (211), Expect = 2e-18 Identities = 42/63 (66%), Positives = 51/63 (80%) Frame = +1 Query: 40 MRKLKEVMDVMKDKASQGKAVILSNQTNLSLLRATTHDYSTPPSHKHLSALLSSGDGPRA 219 M KL ++ ++KDKASQ KA +LS +T LSLLRAT+HD STPP+ KHL+ LLSSGDG RA Sbjct: 1 MTKLTNLIGIIKDKASQSKAALLSKRTTLSLLRATSHDSSTPPTRKHLATLLSSGDGSRA 60 Query: 220 TAS 228 TAS Sbjct: 61 TAS 63 >XP_019462677.1 PREDICTED: putative clathrin assembly protein At4g40080 [Lupinus angustifolius] OIW00392.1 hypothetical protein TanjilG_05742 [Lupinus angustifolius] Length = 326 Score = 85.9 bits (211), Expect = 3e-18 Identities = 41/63 (65%), Positives = 51/63 (80%) Frame = +1 Query: 40 MRKLKEVMDVMKDKASQGKAVILSNQTNLSLLRATTHDYSTPPSHKHLSALLSSGDGPRA 219 M KL E++ ++KDKASQ KAV+LS + LSLLRAT+HD TPP+HKH+S LLSSG+G R Sbjct: 1 MTKLTELLGIIKDKASQSKAVLLSKRATLSLLRATSHDSFTPPTHKHISTLLSSGEGSRV 60 Query: 220 TAS 228 TAS Sbjct: 61 TAS 63 >XP_003552807.1 PREDICTED: putative clathrin assembly protein At4g40080 [Glycine max] KRG97531.1 hypothetical protein GLYMA_18G014200 [Glycine max] Length = 320 Score = 84.0 bits (206), Expect = 1e-17 Identities = 42/63 (66%), Positives = 50/63 (79%) Frame = +1 Query: 40 MRKLKEVMDVMKDKASQGKAVILSNQTNLSLLRATTHDYSTPPSHKHLSALLSSGDGPRA 219 M KLKE++ +MKDKASQGKA ILS + LSLLRAT+HD PP+ H+S LLSSGDG RA Sbjct: 1 MTKLKELIGIMKDKASQGKAAILSKRATLSLLRATSHDSYAPPTCDHISMLLSSGDGSRA 60 Query: 220 TAS 228 T+S Sbjct: 61 TSS 63 >XP_007159704.1 hypothetical protein PHAVU_002G260200g [Phaseolus vulgaris] ESW31698.1 hypothetical protein PHAVU_002G260200g [Phaseolus vulgaris] Length = 326 Score = 84.0 bits (206), Expect = 1e-17 Identities = 40/63 (63%), Positives = 50/63 (79%) Frame = +1 Query: 40 MRKLKEVMDVMKDKASQGKAVILSNQTNLSLLRATTHDYSTPPSHKHLSALLSSGDGPRA 219 M KL ++ ++KDKASQ KA +LS + LSLLRAT+HD S PP+ KHL+ L+SSGDGPRA Sbjct: 1 MTKLTHLIGILKDKASQSKAALLSKRVTLSLLRATSHDCSAPPTSKHLAMLMSSGDGPRA 60 Query: 220 TAS 228 TAS Sbjct: 61 TAS 63 >KRH43124.1 hypothetical protein GLYMA_08G132400 [Glycine max] Length = 314 Score = 83.6 bits (205), Expect = 2e-17 Identities = 41/63 (65%), Positives = 50/63 (79%) Frame = +1 Query: 40 MRKLKEVMDVMKDKASQGKAVILSNQTNLSLLRATTHDYSTPPSHKHLSALLSSGDGPRA 219 M KL ++ ++KDKASQ KA +LS +T L LLRAT+HD STPP+ KHL+ LLSSGDG RA Sbjct: 1 MTKLTHLIGIIKDKASQSKAALLSKRTTLFLLRATSHDSSTPPTRKHLATLLSSGDGSRA 60 Query: 220 TAS 228 TAS Sbjct: 61 TAS 63 >KYP32521.1 Putative clathrin assembly protein At4g40080 family [Cajanus cajan] Length = 335 Score = 81.6 bits (200), Expect = 1e-16 Identities = 40/63 (63%), Positives = 49/63 (77%) Frame = +1 Query: 40 MRKLKEVMDVMKDKASQGKAVILSNQTNLSLLRATTHDYSTPPSHKHLSALLSSGDGPRA 219 M KL ++ ++KDKASQ KA +LS +T LSLLRAT+HD S PP+ KHL+ LLSS DG RA Sbjct: 1 MTKLTHLIGIIKDKASQSKAALLSQRTTLSLLRATSHDSSAPPTRKHLATLLSSADGSRA 60 Query: 220 TAS 228 TAS Sbjct: 61 TAS 63 >XP_013446750.1 clathrin assembly protein [Medicago truncatula] KEH20777.1 clathrin assembly protein [Medicago truncatula] Length = 326 Score = 80.9 bits (198), Expect = 2e-16 Identities = 39/57 (68%), Positives = 47/57 (82%) Frame = +1 Query: 58 VMDVMKDKASQGKAVILSNQTNLSLLRATTHDYSTPPSHKHLSALLSSGDGPRATAS 228 +++++KDKASQ KA +LS T LSLLRATTHD TPP+HKH+S LLSS DG RATAS Sbjct: 9 LINIIKDKASQSKAALLSKPTTLSLLRATTHDSFTPPTHKHISTLLSSTDGSRATAS 65 >ACJ85393.1 unknown [Medicago truncatula] AFK47421.1 unknown [Medicago truncatula] Length = 326 Score = 80.9 bits (198), Expect = 2e-16 Identities = 39/57 (68%), Positives = 47/57 (82%) Frame = +1 Query: 58 VMDVMKDKASQGKAVILSNQTNLSLLRATTHDYSTPPSHKHLSALLSSGDGPRATAS 228 +++++KDKASQ KA +LS T LSLLRATTHD TPP+HKH+S LLSS DG RATAS Sbjct: 9 LINIIKDKASQSKAALLSKPTTLSLLRATTHDSFTPPTHKHISTLLSSTDGSRATAS 65 >GAU19147.1 hypothetical protein TSUD_79700 [Trifolium subterraneum] Length = 333 Score = 79.7 bits (195), Expect = 5e-16 Identities = 38/58 (65%), Positives = 47/58 (81%) Frame = +1 Query: 55 EVMDVMKDKASQGKAVILSNQTNLSLLRATTHDYSTPPSHKHLSALLSSGDGPRATAS 228 +++ ++KDKASQ KA +LS T LSLLRATTH+ TPP+HKH+S LLSS DG RATAS Sbjct: 9 DLIGIIKDKASQSKAALLSKPTTLSLLRATTHNSFTPPTHKHISTLLSSSDGSRATAS 66 >XP_014493489.1 PREDICTED: putative clathrin assembly protein At4g40080 [Vigna radiata var. radiata] Length = 340 Score = 79.0 bits (193), Expect = 1e-15 Identities = 40/63 (63%), Positives = 47/63 (74%) Frame = +1 Query: 40 MRKLKEVMDVMKDKASQGKAVILSNQTNLSLLRATTHDYSTPPSHKHLSALLSSGDGPRA 219 M KLKE++ +KDKASQGKA ILS + LSLLRAT+HD TPP+ HLS L +GDG R Sbjct: 1 MTKLKELIGRLKDKASQGKAAILSKRATLSLLRATSHDPFTPPTSNHLSTFLIAGDGSRV 60 Query: 220 TAS 228 TAS Sbjct: 61 TAS 63 >XP_017416838.1 PREDICTED: putative clathrin assembly protein At4g40080 [Vigna angularis] KOM39711.1 hypothetical protein LR48_Vigan03g309300 [Vigna angularis] BAT86549.1 hypothetical protein VIGAN_04421600 [Vigna angularis var. angularis] Length = 342 Score = 79.0 bits (193), Expect = 1e-15 Identities = 40/63 (63%), Positives = 47/63 (74%) Frame = +1 Query: 40 MRKLKEVMDVMKDKASQGKAVILSNQTNLSLLRATTHDYSTPPSHKHLSALLSSGDGPRA 219 M KLKE++ +KDKASQGKA ILS + LSLLRAT+HD TPP+ HLS L +GDG R Sbjct: 1 MTKLKELIGRLKDKASQGKAAILSKRATLSLLRATSHDPFTPPTSSHLSTFLIAGDGSRV 60 Query: 220 TAS 228 TAS Sbjct: 61 TAS 63