BLASTX nr result
ID: Glycyrrhiza29_contig00038781
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza29_contig00038781 (313 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KYP54934.1 Retrovirus-related Pol polyprotein from transposon TN... 57 1e-07 KYP41477.1 Retrovirus-related Pol polyprotein from transposon TN... 55 1e-06 >KYP54934.1 Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cajanus cajan] Length = 227 Score = 57.0 bits (136), Expect = 1e-07 Identities = 25/34 (73%), Positives = 29/34 (85%) Frame = +1 Query: 211 NGRKYVNLPLTTFLKEYGIVHELTCVDTNQQNGV 312 NGR+YVN L+ FLKE G++HELTCVDT QQNGV Sbjct: 33 NGREYVNQNLSNFLKEKGVIHELTCVDTPQQNGV 66 >KYP41477.1 Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cajanus cajan] Length = 916 Score = 55.5 bits (132), Expect = 1e-06 Identities = 24/34 (70%), Positives = 29/34 (85%) Frame = +1 Query: 211 NGRKYVNLPLTTFLKEYGIVHELTCVDTNQQNGV 312 NGR+YVN L+ FLKE G++HELTCVD+ QQNGV Sbjct: 248 NGREYVNQNLSNFLKEKGVIHELTCVDSPQQNGV 281