BLASTX nr result
ID: Glycyrrhiza29_contig00038721
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza29_contig00038721 (315 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007154979.1 hypothetical protein PHAVU_003G162600g [Phaseolus... 77 2e-14 XP_014508003.1 PREDICTED: zinc finger CCCH domain-containing pro... 76 3e-14 XP_017412945.1 PREDICTED: zinc finger CCCH domain-containing pro... 76 3e-14 XP_016179224.1 PREDICTED: zinc finger CCCH domain-containing pro... 73 5e-13 XP_015944667.1 PREDICTED: zinc finger CCCH domain-containing pro... 73 5e-13 XP_011046665.1 PREDICTED: zinc finger CCCH domain-containing pro... 73 6e-13 XP_002313732.1 zinc finger family protein [Populus trichocarpa] ... 73 6e-13 XP_010088337.1 Zinc finger CCCH domain-containing protein 39 [Mo... 72 8e-13 XP_002524459.1 PREDICTED: zinc finger CCCH domain-containing pro... 72 8e-13 XP_003550830.1 PREDICTED: zinc finger CCCH domain-containing pro... 72 2e-12 XP_012078744.1 PREDICTED: zinc finger CCCH domain-containing pro... 70 4e-12 KYP51127.1 Zinc finger CCCH domain-containing protein 39 [Cajanu... 69 1e-11 XP_004508522.1 PREDICTED: zinc finger CCCH domain-containing pro... 68 2e-11 OMO81277.1 Zinc finger, CCCH-type [Corchorus capsularis] 68 3e-11 OMP09147.1 Zinc finger, CCCH-type [Corchorus olitorius] 68 3e-11 XP_010049974.1 PREDICTED: zinc finger CCCH domain-containing pro... 68 4e-11 XP_017611520.1 PREDICTED: zinc finger CCCH domain-containing pro... 67 5e-11 XP_019452281.1 PREDICTED: zinc finger CCCH domain-containing pro... 67 1e-10 OAY31661.1 hypothetical protein MANES_14G130400 [Manihot esculen... 66 1e-10 KJB07717.1 hypothetical protein B456_001G040700 [Gossypium raimo... 65 2e-10 >XP_007154979.1 hypothetical protein PHAVU_003G162600g [Phaseolus vulgaris] ESW26973.1 hypothetical protein PHAVU_003G162600g [Phaseolus vulgaris] Length = 344 Score = 76.6 bits (187), Expect = 2e-14 Identities = 33/39 (84%), Positives = 36/39 (92%) Frame = +3 Query: 3 EEEQGKKHLLRWKGTKKINRIYGDWIDDLPLVHNLASRV 119 EEEQGKK+LL+WKG KKINRIYGDW+DDLPLVHNL RV Sbjct: 304 EEEQGKKYLLKWKGPKKINRIYGDWLDDLPLVHNLPGRV 342 >XP_014508003.1 PREDICTED: zinc finger CCCH domain-containing protein 39 [Vigna radiata var. radiata] Length = 346 Score = 76.3 bits (186), Expect = 3e-14 Identities = 33/39 (84%), Positives = 35/39 (89%) Frame = +3 Query: 3 EEEQGKKHLLRWKGTKKINRIYGDWIDDLPLVHNLASRV 119 EEEQGKKHLL+WKG KKINRIYGDW+DDLPL HNL RV Sbjct: 306 EEEQGKKHLLKWKGPKKINRIYGDWLDDLPLGHNLPGRV 344 >XP_017412945.1 PREDICTED: zinc finger CCCH domain-containing protein 39 [Vigna angularis] KOM33056.1 hypothetical protein LR48_Vigan01g261200 [Vigna angularis] BAT76378.1 hypothetical protein VIGAN_01436700 [Vigna angularis var. angularis] Length = 346 Score = 76.3 bits (186), Expect = 3e-14 Identities = 33/39 (84%), Positives = 35/39 (89%) Frame = +3 Query: 3 EEEQGKKHLLRWKGTKKINRIYGDWIDDLPLVHNLASRV 119 EEEQGKKHLL+WKG KKINRIYGDW+DDLPL HNL RV Sbjct: 306 EEEQGKKHLLKWKGPKKINRIYGDWLDDLPLGHNLPGRV 344 >XP_016179224.1 PREDICTED: zinc finger CCCH domain-containing protein 39 [Arachis ipaensis] Length = 366 Score = 73.2 bits (178), Expect = 5e-13 Identities = 32/41 (78%), Positives = 35/41 (85%) Frame = +3 Query: 3 EEEQGKKHLLRWKGTKKINRIYGDWIDDLPLVHNLASRVET 125 E+ QG K LL+WKG KKINRIYGDW+DD PLVHNL SRVET Sbjct: 326 EDGQGNKSLLKWKGFKKINRIYGDWLDDFPLVHNLPSRVET 366 >XP_015944667.1 PREDICTED: zinc finger CCCH domain-containing protein 39 [Arachis duranensis] Length = 366 Score = 73.2 bits (178), Expect = 5e-13 Identities = 32/41 (78%), Positives = 35/41 (85%) Frame = +3 Query: 3 EEEQGKKHLLRWKGTKKINRIYGDWIDDLPLVHNLASRVET 125 E+ QG K LL+WKG KKINRIYGDW+DD PLVHNL SRVET Sbjct: 326 EDGQGNKSLLKWKGFKKINRIYGDWLDDFPLVHNLPSRVET 366 >XP_011046665.1 PREDICTED: zinc finger CCCH domain-containing protein 39-like isoform X1 [Populus euphratica] Length = 341 Score = 72.8 bits (177), Expect = 6e-13 Identities = 31/41 (75%), Positives = 37/41 (90%) Frame = +3 Query: 3 EEEQGKKHLLRWKGTKKINRIYGDWIDDLPLVHNLASRVET 125 EEEQGKK LL+WKG KKINRIY DW+DDLPLVHNL ++V++ Sbjct: 301 EEEQGKKCLLKWKGQKKINRIYADWLDDLPLVHNLTNQVQS 341 >XP_002313732.1 zinc finger family protein [Populus trichocarpa] EEE87687.1 zinc finger family protein [Populus trichocarpa] Length = 341 Score = 72.8 bits (177), Expect = 6e-13 Identities = 31/41 (75%), Positives = 37/41 (90%) Frame = +3 Query: 3 EEEQGKKHLLRWKGTKKINRIYGDWIDDLPLVHNLASRVET 125 EEEQGKK LL+WKG KKINRIY DW+DDLPLVHNL ++V++ Sbjct: 301 EEEQGKKCLLKWKGQKKINRIYADWLDDLPLVHNLTNQVQS 341 >XP_010088337.1 Zinc finger CCCH domain-containing protein 39 [Morus notabilis] EXB33953.1 Zinc finger CCCH domain-containing protein 39 [Morus notabilis] Length = 341 Score = 72.4 bits (176), Expect = 8e-13 Identities = 32/41 (78%), Positives = 36/41 (87%) Frame = +3 Query: 3 EEEQGKKHLLRWKGTKKINRIYGDWIDDLPLVHNLASRVET 125 E+ QGKK LL+WKG KKINRIY DW+DDLPLVHNL SRVE+ Sbjct: 301 EDVQGKKCLLKWKGPKKINRIYADWLDDLPLVHNLPSRVES 341 >XP_002524459.1 PREDICTED: zinc finger CCCH domain-containing protein 39 [Ricinus communis] EEF37899.1 conserved hypothetical protein [Ricinus communis] Length = 341 Score = 72.4 bits (176), Expect = 8e-13 Identities = 31/41 (75%), Positives = 36/41 (87%) Frame = +3 Query: 3 EEEQGKKHLLRWKGTKKINRIYGDWIDDLPLVHNLASRVET 125 EE QGKK L+WKG KKINRIYGDW+DDLPLVHNL ++VE+ Sbjct: 301 EERQGKKCFLKWKGFKKINRIYGDWLDDLPLVHNLTNQVES 341 >XP_003550830.1 PREDICTED: zinc finger CCCH domain-containing protein 39-like [Glycine max] KHN15111.1 Zinc finger CCCH domain-containing protein 39 [Glycine soja] KRH03719.1 hypothetical protein GLYMA_17G116700 [Glycine max] Length = 347 Score = 71.6 bits (174), Expect = 2e-12 Identities = 31/41 (75%), Positives = 36/41 (87%) Frame = +3 Query: 3 EEEQGKKHLLRWKGTKKINRIYGDWIDDLPLVHNLASRVET 125 E+E+ KK+LL+WKG KKINRIYGDW+DDLPLVHNL RV T Sbjct: 307 EKERDKKYLLKWKGHKKINRIYGDWLDDLPLVHNLPGRVGT 347 >XP_012078744.1 PREDICTED: zinc finger CCCH domain-containing protein 39 [Jatropha curcas] KDP32373.1 hypothetical protein JCGZ_13298 [Jatropha curcas] Length = 348 Score = 70.5 bits (171), Expect = 4e-12 Identities = 31/41 (75%), Positives = 36/41 (87%) Frame = +3 Query: 3 EEEQGKKHLLRWKGTKKINRIYGDWIDDLPLVHNLASRVET 125 EE QGKK LL+WKG KKINRIYGDW+DDLPLV NL ++VE+ Sbjct: 308 EEGQGKKCLLKWKGPKKINRIYGDWLDDLPLVQNLTNQVES 348 >KYP51127.1 Zinc finger CCCH domain-containing protein 39 [Cajanus cajan] Length = 343 Score = 68.9 bits (167), Expect = 1e-11 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = +3 Query: 3 EEEQGKKHLLRWKGTKKINRIYGDWIDDLPLV 98 EEEQGKKHLL+WKG KKINRIYGDW+DDLPLV Sbjct: 310 EEEQGKKHLLKWKGPKKINRIYGDWLDDLPLV 341 >XP_004508522.1 PREDICTED: zinc finger CCCH domain-containing protein 39 [Cicer arietinum] XP_004508523.1 PREDICTED: zinc finger CCCH domain-containing protein 39 [Cicer arietinum] Length = 328 Score = 68.2 bits (165), Expect = 2e-11 Identities = 35/42 (83%), Positives = 35/42 (83%), Gaps = 1/42 (2%) Frame = +3 Query: 3 EEEQGKKHLLRWKGTKKINRIYGDWIDDLPLV-HNLASRVET 125 EEEQ KKHLLR K KKINRIYGDWIDDLPLV HNL S VET Sbjct: 287 EEEQTKKHLLRLKVNKKINRIYGDWIDDLPLVLHNLPSTVET 328 >OMO81277.1 Zinc finger, CCCH-type [Corchorus capsularis] Length = 352 Score = 68.2 bits (165), Expect = 3e-11 Identities = 28/41 (68%), Positives = 35/41 (85%) Frame = +3 Query: 3 EEEQGKKHLLRWKGTKKINRIYGDWIDDLPLVHNLASRVET 125 EE Q KK L +WKG +KINRIYGDW+DD+PLVHNL ++VE+ Sbjct: 312 EETQAKKCLFKWKGARKINRIYGDWLDDMPLVHNLPNQVES 352 >OMP09147.1 Zinc finger, CCCH-type [Corchorus olitorius] Length = 354 Score = 68.2 bits (165), Expect = 3e-11 Identities = 28/41 (68%), Positives = 35/41 (85%) Frame = +3 Query: 3 EEEQGKKHLLRWKGTKKINRIYGDWIDDLPLVHNLASRVET 125 EE Q KK L +WKG +KINRIYGDW+DD+PLVHNL ++VE+ Sbjct: 314 EETQAKKCLFKWKGARKINRIYGDWLDDMPLVHNLPNQVES 354 >XP_010049974.1 PREDICTED: zinc finger CCCH domain-containing protein 39 [Eucalyptus grandis] KCW82809.1 hypothetical protein EUGRSUZ_C04180 [Eucalyptus grandis] Length = 342 Score = 67.8 bits (164), Expect = 4e-11 Identities = 30/41 (73%), Positives = 35/41 (85%) Frame = +3 Query: 3 EEEQGKKHLLRWKGTKKINRIYGDWIDDLPLVHNLASRVET 125 EE Q KK LLRWKG KKIN+IYGDW+DDLPLV NL ++VE+ Sbjct: 302 EEAQSKKCLLRWKGHKKINQIYGDWLDDLPLVQNLPNKVES 342 >XP_017611520.1 PREDICTED: zinc finger CCCH domain-containing protein 39 [Gossypium arboreum] XP_017611600.1 PREDICTED: zinc finger CCCH domain-containing protein 39 [Gossypium arboreum] KHG27152.1 hypothetical protein F383_08801 [Gossypium arboreum] Length = 355 Score = 67.4 bits (163), Expect = 5e-11 Identities = 28/41 (68%), Positives = 35/41 (85%) Frame = +3 Query: 3 EEEQGKKHLLRWKGTKKINRIYGDWIDDLPLVHNLASRVET 125 E+ Q KK L +WKG +KINRIYGDW+DD+PLVHNL S+VE+ Sbjct: 315 EKAQAKKCLFKWKGPRKINRIYGDWLDDMPLVHNLPSQVES 355 >XP_019452281.1 PREDICTED: zinc finger CCCH domain-containing protein 39-like [Lupinus angustifolius] OIW18569.1 hypothetical protein TanjilG_13321 [Lupinus angustifolius] Length = 375 Score = 66.6 bits (161), Expect = 1e-10 Identities = 29/41 (70%), Positives = 33/41 (80%) Frame = +3 Query: 3 EEEQGKKHLLRWKGTKKINRIYGDWIDDLPLVHNLASRVET 125 E EQGKK LL+WKG KKINRIY DW+DD PLV N+A+ ET Sbjct: 335 EVEQGKKSLLKWKGPKKINRIYADWLDDFPLVQNVANGAET 375 >OAY31661.1 hypothetical protein MANES_14G130400 [Manihot esculenta] OAY31662.1 hypothetical protein MANES_14G130400 [Manihot esculenta] Length = 344 Score = 66.2 bits (160), Expect = 1e-10 Identities = 29/41 (70%), Positives = 34/41 (82%) Frame = +3 Query: 3 EEEQGKKHLLRWKGTKKINRIYGDWIDDLPLVHNLASRVET 125 EE Q KK L +WKG KKINRIYGDW+DDLPLV NL ++VE+ Sbjct: 304 EEGQSKKCLFKWKGPKKINRIYGDWLDDLPLVQNLPNQVES 344 >KJB07717.1 hypothetical protein B456_001G040700 [Gossypium raimondii] Length = 326 Score = 65.5 bits (158), Expect = 2e-10 Identities = 27/41 (65%), Positives = 34/41 (82%) Frame = +3 Query: 3 EEEQGKKHLLRWKGTKKINRIYGDWIDDLPLVHNLASRVET 125 E+ Q K L +WKG +KINRIYGDW+DD+PLVHNL S+VE+ Sbjct: 286 EKAQAKNCLFKWKGPRKINRIYGDWLDDMPLVHNLPSQVES 326