BLASTX nr result
ID: Glycyrrhiza29_contig00038706
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza29_contig00038706 (342 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_013469932.1 cysteine-rich RLK (receptor-like kinase) protein ... 69 1e-11 XP_013469931.1 cysteine-rich RLK (receptor-like kinase) protein ... 69 1e-11 XP_013469929.1 salt stress response/antifungal domain protein [M... 67 6e-11 AFK43013.1 unknown [Medicago truncatula] 66 1e-10 GAU15359.1 hypothetical protein TSUD_04280 [Trifolium subterraneum] 65 4e-10 XP_003589297.2 cysteine-rich receptor-kinase-like protein [Medic... 65 6e-10 KOM36175.1 hypothetical protein LR48_Vigan02g232500 [Vigna angul... 62 3e-09 XP_017414218.1 PREDICTED: cysteine-rich receptor-like protein ki... 62 4e-09 XP_014513307.1 PREDICTED: cysteine-rich receptor-like protein ki... 62 4e-09 GAU15358.1 hypothetical protein TSUD_04270 [Trifolium subterraneum] 62 9e-09 XP_013466037.1 cysteine-rich receptor-kinase-like protein [Medic... 60 2e-08 XP_019441546.1 PREDICTED: cysteine-rich repeat secretory protein... 59 5e-08 XP_019441545.1 PREDICTED: cysteine-rich repeat secretory protein... 59 5e-08 XP_019441544.1 PREDICTED: cysteine-rich repeat secretory protein... 59 5e-08 OIW12840.1 hypothetical protein TanjilG_24773 [Lupinus angustifo... 59 5e-08 XP_019441543.1 PREDICTED: cysteine-rich repeat secretory protein... 59 5e-08 XP_014511962.1 PREDICTED: cysteine-rich receptor-like protein ki... 58 9e-08 KRH35619.1 hypothetical protein GLYMA_10G254000 [Glycine max] 59 9e-08 NP_001234947.1 receptor-like protein kinase precursor [Glycine m... 59 1e-07 KHN23189.1 Cysteine-rich receptor-like protein kinase 29 [Glycin... 59 1e-07 >XP_013469932.1 cysteine-rich RLK (receptor-like kinase) protein [Medicago truncatula] KEH43970.1 cysteine-rich RLK (receptor-like kinase) protein [Medicago truncatula] Length = 265 Score = 68.9 bits (167), Expect = 1e-11 Identities = 31/36 (86%), Positives = 32/36 (88%) Frame = -3 Query: 340 IIEVPRCCSNRIGARIIRPSCNLRFETSFQFYDPTA 233 I EV RCCSNRIGARIIRPSCNLRFETS+QFY P A Sbjct: 223 IAEVSRCCSNRIGARIIRPSCNLRFETSYQFYQPKA 258 >XP_013469931.1 cysteine-rich RLK (receptor-like kinase) protein [Medicago truncatula] KEH43969.1 cysteine-rich RLK (receptor-like kinase) protein [Medicago truncatula] Length = 282 Score = 68.9 bits (167), Expect = 1e-11 Identities = 31/36 (86%), Positives = 32/36 (88%) Frame = -3 Query: 340 IIEVPRCCSNRIGARIIRPSCNLRFETSFQFYDPTA 233 I EV RCCSNRIGARIIRPSCNLRFETS+QFY P A Sbjct: 240 IAEVSRCCSNRIGARIIRPSCNLRFETSYQFYQPKA 275 >XP_013469929.1 salt stress response/antifungal domain protein [Medicago truncatula] KEH43967.1 salt stress response/antifungal domain protein [Medicago truncatula] Length = 311 Score = 67.4 bits (163), Expect = 6e-11 Identities = 33/53 (62%), Positives = 36/53 (67%), Gaps = 2/53 (3%) Frame = -3 Query: 340 IIEVPRCCSNRIGARIIRPSCNLRFETSFQFYDPTA--PPLQPHGDPRYHAPH 188 I E+ RCC NRIGARI+RPSCNLRFETSFQFY A P QP +PH Sbjct: 226 ITEISRCCKNRIGARIVRPSCNLRFETSFQFYQTIADSPSQQPPSPIPSASPH 278 >AFK43013.1 unknown [Medicago truncatula] Length = 265 Score = 66.2 bits (160), Expect = 1e-10 Identities = 30/36 (83%), Positives = 31/36 (86%) Frame = -3 Query: 340 IIEVPRCCSNRIGARIIRPSCNLRFETSFQFYDPTA 233 I EV RCCSNRI ARIIRPSCNLRFETS+QFY P A Sbjct: 223 IAEVSRCCSNRIDARIIRPSCNLRFETSYQFYQPKA 258 >GAU15359.1 hypothetical protein TSUD_04280 [Trifolium subterraneum] Length = 543 Score = 65.5 bits (158), Expect = 4e-10 Identities = 25/43 (58%), Positives = 33/43 (76%) Frame = -3 Query: 334 EVPRCCSNRIGARIIRPSCNLRFETSFQFYDPTAPPLQPHGDP 206 ++P CC+N+IG R++RPSCN+RFETSF FY+P A P P P Sbjct: 95 QIPSCCNNKIGGRVVRPSCNMRFETSFLFYEPRASPPPPPPSP 137 >XP_003589297.2 cysteine-rich receptor-kinase-like protein [Medicago truncatula] AES59548.2 cysteine-rich receptor-kinase-like protein [Medicago truncatula] Length = 670 Score = 65.1 bits (157), Expect = 6e-10 Identities = 24/43 (55%), Positives = 33/43 (76%) Frame = -3 Query: 334 EVPRCCSNRIGARIIRPSCNLRFETSFQFYDPTAPPLQPHGDP 206 ++P CC+N+IG R++RPSCN+RFETS+ FY+P A P P P Sbjct: 223 QIPSCCNNKIGGRVVRPSCNMRFETSYLFYEPRASPPPPPSSP 265 >KOM36175.1 hypothetical protein LR48_Vigan02g232500 [Vigna angularis] Length = 244 Score = 62.0 bits (149), Expect = 3e-09 Identities = 26/37 (70%), Positives = 31/37 (83%) Frame = -3 Query: 340 IIEVPRCCSNRIGARIIRPSCNLRFETSFQFYDPTAP 230 I E+PRCC+NRIGARIIRPSC +R+ET F F+ P AP Sbjct: 206 IAELPRCCNNRIGARIIRPSCYVRYETDFLFFGPPAP 242 >XP_017414218.1 PREDICTED: cysteine-rich receptor-like protein kinase 26 [Vigna angularis] BAT93989.1 hypothetical protein VIGAN_08055100 [Vigna angularis var. angularis] Length = 260 Score = 62.0 bits (149), Expect = 4e-09 Identities = 26/37 (70%), Positives = 31/37 (83%) Frame = -3 Query: 340 IIEVPRCCSNRIGARIIRPSCNLRFETSFQFYDPTAP 230 I E+PRCC+NRIGARIIRPSC +R+ET F F+ P AP Sbjct: 222 IAELPRCCNNRIGARIIRPSCYVRYETDFLFFGPPAP 258 >XP_014513307.1 PREDICTED: cysteine-rich receptor-like protein kinase 26 [Vigna radiata var. radiata] Length = 260 Score = 62.0 bits (149), Expect = 4e-09 Identities = 26/37 (70%), Positives = 31/37 (83%) Frame = -3 Query: 340 IIEVPRCCSNRIGARIIRPSCNLRFETSFQFYDPTAP 230 I E+PRCC+NRIGARIIRPSC +R+ET F F+ P AP Sbjct: 222 IAELPRCCNNRIGARIIRPSCYVRYETDFLFFGPPAP 258 >GAU15358.1 hypothetical protein TSUD_04270 [Trifolium subterraneum] Length = 1040 Score = 61.6 bits (148), Expect = 9e-09 Identities = 25/40 (62%), Positives = 31/40 (77%), Gaps = 1/40 (2%) Frame = -3 Query: 322 CCSNRIGARIIRPSCNLRFETSFQFYDPTAP-PLQPHGDP 206 CC ++IG R++RPSCN+RFETSF+FYDPT P P P P Sbjct: 608 CCKDKIGGRVVRPSCNMRFETSFRFYDPTTPQPPPPSSTP 647 >XP_013466037.1 cysteine-rich receptor-kinase-like protein [Medicago truncatula] KEH40076.1 cysteine-rich receptor-kinase-like protein [Medicago truncatula] Length = 678 Score = 60.5 bits (145), Expect = 2e-08 Identities = 23/35 (65%), Positives = 28/35 (80%) Frame = -3 Query: 322 CCSNRIGARIIRPSCNLRFETSFQFYDPTAPPLQP 218 CC ++ G R++RPSCN+RFET F FYDPTAPP P Sbjct: 241 CCKDKKGGRVVRPSCNMRFETDFLFYDPTAPPPPP 275 >XP_019441546.1 PREDICTED: cysteine-rich repeat secretory protein 38-like isoform X4 [Lupinus angustifolius] Length = 299 Score = 59.3 bits (142), Expect = 5e-08 Identities = 27/50 (54%), Positives = 32/50 (64%), Gaps = 14/50 (28%) Frame = -3 Query: 331 VPRCCSNRIGARIIRPSCNLRFETSFQFYD--------------PTAPPL 224 +P CC+NRIGARI+RPSCNLR+ET F FY+ PT PPL Sbjct: 220 IPSCCNNRIGARIVRPSCNLRYETGFPFYEAIAYAPSPAPSTDAPTPPPL 269 >XP_019441545.1 PREDICTED: cysteine-rich repeat secretory protein 38-like isoform X3 [Lupinus angustifolius] Length = 302 Score = 59.3 bits (142), Expect = 5e-08 Identities = 28/49 (57%), Positives = 33/49 (67%), Gaps = 2/49 (4%) Frame = -3 Query: 331 VPRCCSNRIGARIIRPSCNLRFETSFQFYDPT--APPLQPHGDPRYHAP 191 +P CC+NRIGARI+RPSCNLR+ET F FY+ AP P D AP Sbjct: 220 IPSCCNNRIGARIVRPSCNLRYETGFPFYEAIAYAPSPAPSTDAPPPAP 268 >XP_019441544.1 PREDICTED: cysteine-rich repeat secretory protein 38-like isoform X2 [Lupinus angustifolius] Length = 308 Score = 59.3 bits (142), Expect = 5e-08 Identities = 28/49 (57%), Positives = 33/49 (67%), Gaps = 2/49 (4%) Frame = -3 Query: 331 VPRCCSNRIGARIIRPSCNLRFETSFQFYDPT--APPLQPHGDPRYHAP 191 +P CC+NRIGARI+RPSCNLR+ET F FY+ AP P D AP Sbjct: 220 IPSCCNNRIGARIVRPSCNLRYETGFPFYEAIAYAPSPAPSTDAPPPAP 268 >OIW12840.1 hypothetical protein TanjilG_24773 [Lupinus angustifolius] Length = 320 Score = 59.3 bits (142), Expect = 5e-08 Identities = 28/49 (57%), Positives = 33/49 (67%), Gaps = 2/49 (4%) Frame = -3 Query: 331 VPRCCSNRIGARIIRPSCNLRFETSFQFYDPT--APPLQPHGDPRYHAP 191 +P CC+NRIGARI+RPSCNLR+ET F FY+ AP P D AP Sbjct: 220 IPSCCNNRIGARIVRPSCNLRYETGFPFYEAIAYAPSPAPSTDAPPPAP 268 >XP_019441543.1 PREDICTED: cysteine-rich repeat secretory protein 38-like isoform X1 [Lupinus angustifolius] Length = 333 Score = 59.3 bits (142), Expect = 5e-08 Identities = 28/49 (57%), Positives = 33/49 (67%), Gaps = 2/49 (4%) Frame = -3 Query: 331 VPRCCSNRIGARIIRPSCNLRFETSFQFYDPT--APPLQPHGDPRYHAP 191 +P CC+NRIGARI+RPSCNLR+ET F FY+ AP P D AP Sbjct: 220 IPSCCNNRIGARIVRPSCNLRYETGFPFYEAIAYAPSPAPSTDAPPPAP 268 >XP_014511962.1 PREDICTED: cysteine-rich receptor-like protein kinase 29 [Vigna radiata var. radiata] Length = 246 Score = 58.2 bits (139), Expect = 9e-08 Identities = 28/55 (50%), Positives = 33/55 (60%), Gaps = 5/55 (9%) Frame = -3 Query: 340 IIEVPRCCSNRIGARIIRPSCNLRFETSFQFYD-----PTAPPLQPHGDPRYHAP 191 I EVP CC ++IG RI+RPSCNLR+ETS FY P AP P P + P Sbjct: 151 INEVPNCCHSKIGTRIVRPSCNLRYETSSLFYGAQTYIPPAPTPSPSPSPSFSPP 205 >KRH35619.1 hypothetical protein GLYMA_10G254000 [Glycine max] Length = 319 Score = 58.5 bits (140), Expect = 9e-08 Identities = 27/54 (50%), Positives = 33/54 (61%) Frame = -3 Query: 340 IIEVPRCCSNRIGARIIRPSCNLRFETSFQFYDPTAPPLQPHGDPRYHAPHFLP 179 I EV CC++R+G RI+RPSCNLRFET+ FY A P P P P +P Sbjct: 226 IKEVSHCCNSRLGVRIVRPSCNLRFETASLFYGTPAYPPSPSPSPSPSQPLLMP 279 >NP_001234947.1 receptor-like protein kinase precursor [Glycine max] ACM89514.1 receptor-like protein kinase [Glycine max] Length = 667 Score = 58.5 bits (140), Expect = 1e-07 Identities = 27/54 (50%), Positives = 33/54 (61%) Frame = -3 Query: 340 IIEVPRCCSNRIGARIIRPSCNLRFETSFQFYDPTAPPLQPHGDPRYHAPHFLP 179 I EV CC++R+G RI+RPSCNLRFET+ FY A P P P P +P Sbjct: 226 IKEVSHCCNSRLGVRIVRPSCNLRFETASLFYGTPAYPPSPSPSPSPSQPLLMP 279 >KHN23189.1 Cysteine-rich receptor-like protein kinase 29 [Glycine soja] Length = 821 Score = 58.5 bits (140), Expect = 1e-07 Identities = 27/54 (50%), Positives = 33/54 (61%) Frame = -3 Query: 340 IIEVPRCCSNRIGARIIRPSCNLRFETSFQFYDPTAPPLQPHGDPRYHAPHFLP 179 I EV CC++R+G RI+RPSCNLRFET+ FY A P P P P +P Sbjct: 93 IKEVSHCCNSRLGVRIVRPSCNLRFETASLFYGTPAYPPSPSPSPSPSQPLLMP 146