BLASTX nr result
ID: Glycyrrhiza29_contig00038629
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza29_contig00038629 (468 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_013462724.1 DVL family protein [Medicago truncatula] KEH36759... 67 2e-11 KZM85432.1 hypothetical protein DCAR_027146 [Daucus carota subsp... 60 9e-08 XP_011091052.1 PREDICTED: uncharacterized protein LOC105171589 [... 55 1e-07 XP_019224928.1 PREDICTED: uncharacterized protein LOC109206553 [... 51 5e-06 >XP_013462724.1 DVL family protein [Medicago truncatula] KEH36759.1 DVL family protein [Medicago truncatula] Length = 104 Score = 66.6 bits (161), Expect = 2e-11 Identities = 27/38 (71%), Positives = 33/38 (86%) Frame = -1 Query: 375 LMGNTGRRFSKWRRFVRQQKGKFYIMRVCISMLLNWHK 262 +MG +RF+KWRR VRQQ+GK YIMR+CI+MLLNWHK Sbjct: 1 MMGCMSKRFAKWRRMVRQQQGKIYIMRICITMLLNWHK 38 >KZM85432.1 hypothetical protein DCAR_027146 [Daucus carota subsp. sativus] Length = 321 Score = 60.1 bits (144), Expect = 9e-08 Identities = 28/39 (71%), Positives = 31/39 (79%) Frame = -1 Query: 372 MGNTGRRFSKWRRFVRQQKGKFYIMRVCISMLLNWHKYS 256 MG RRF+K +RFVRQQ+GK YIMR CISMLL W KYS Sbjct: 278 MGRLVRRFAKLKRFVRQQRGKLYIMRECISMLLCWDKYS 316 >XP_011091052.1 PREDICTED: uncharacterized protein LOC105171589 [Sesamum indicum] Length = 37 Score = 54.7 bits (130), Expect = 1e-07 Identities = 25/36 (69%), Positives = 29/36 (80%), Gaps = 1/36 (2%) Frame = -1 Query: 360 GRRFSKWRRFVRQQKGKFYIMRVCISMLLNW-HKYS 256 G+RF KWRR V+Q +GK YIMRVCI+MLL W KYS Sbjct: 2 GKRFGKWRRMVKQLRGKLYIMRVCITMLLCWDDKYS 37 >XP_019224928.1 PREDICTED: uncharacterized protein LOC109206553 [Nicotiana attenuata] Length = 55 Score = 51.2 bits (121), Expect = 5e-06 Identities = 22/33 (66%), Positives = 26/33 (78%) Frame = -1 Query: 354 RFSKWRRFVRQQKGKFYIMRVCISMLLNWHKYS 256 RF K +R V+QQKGK YIMR+CI+MLL W YS Sbjct: 23 RFEKVKRMVKQQKGKLYIMRICITMLLCWDNYS 55