BLASTX nr result
ID: Glycyrrhiza29_contig00038365
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza29_contig00038365 (404 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_014625174.1 PREDICTED: pentatricopeptide repeat-containing pr... 55 2e-06 XP_013457923.1 PPR containing plant-like protein [Medicago trunc... 54 8e-06 KRH56887.1 hypothetical protein GLYMA_05G024900 [Glycine max] 54 8e-06 >XP_014625174.1 PREDICTED: pentatricopeptide repeat-containing protein At5g61370, mitochondrial-like [Glycine max] XP_014625175.1 PREDICTED: pentatricopeptide repeat-containing protein At5g61370, mitochondrial-like [Glycine max] XP_014625176.1 PREDICTED: pentatricopeptide repeat-containing protein At5g61370, mitochondrial-like [Glycine max] KRH03514.1 hypothetical protein GLYMA_17G102300 [Glycine max] KRH03515.1 hypothetical protein GLYMA_17G102300 [Glycine max] Length = 490 Score = 55.5 bits (132), Expect = 2e-06 Identities = 24/37 (64%), Positives = 27/37 (72%) Frame = -1 Query: 113 MKFKMHVLLNPAWKRCWLQNMSTQKFQLLSVSLYSTL 3 M+FKMH +L PAWKR WLQNM T Q+L S YSTL Sbjct: 1 MRFKMHAMLKPAWKRFWLQNMRTHNLQILPFSHYSTL 37 >XP_013457923.1 PPR containing plant-like protein [Medicago truncatula] KEH31954.1 PPR containing plant-like protein [Medicago truncatula] Length = 422 Score = 53.9 bits (128), Expect = 8e-06 Identities = 26/33 (78%), Positives = 28/33 (84%) Frame = -1 Query: 101 MHVLLNPAWKRCWLQNMSTQKFQLLSVSLYSTL 3 MH LLN A+KR WLQN ST KFQLLSVSL+STL Sbjct: 1 MHFLLNSAFKRYWLQNTSTHKFQLLSVSLFSTL 33 >KRH56887.1 hypothetical protein GLYMA_05G024900 [Glycine max] Length = 453 Score = 53.9 bits (128), Expect = 8e-06 Identities = 24/33 (72%), Positives = 25/33 (75%) Frame = -1 Query: 101 MHVLLNPAWKRCWLQNMSTQKFQLLSVSLYSTL 3 MH LL PAWKR WLQNMSTQ FQ+ S YSTL Sbjct: 1 MHALLKPAWKRFWLQNMSTQNFQIFPFSHYSTL 33