BLASTX nr result
ID: Glycyrrhiza29_contig00038307
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza29_contig00038307 (499 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_012573866.1 PREDICTED: DNA-directed RNA polymerase 1B, mitoch... 83 2e-15 XP_004509767.1 PREDICTED: DNA-directed RNA polymerase 1B, mitoch... 83 2e-15 XP_003628716.1 DNA-directed RNA polymerase [Medicago truncatula]... 65 9e-10 OIW16720.1 hypothetical protein TanjilG_14490 [Lupinus angustifo... 56 5e-06 XP_019429435.1 PREDICTED: DNA-directed RNA polymerase 1B, mitoch... 56 5e-06 >XP_012573866.1 PREDICTED: DNA-directed RNA polymerase 1B, mitochondrial-like isoform X2 [Cicer arietinum] Length = 1002 Score = 83.2 bits (204), Expect = 2e-15 Identities = 47/72 (65%), Positives = 53/72 (73%), Gaps = 1/72 (1%) Frame = +1 Query: 286 QHPNFPEKTVPPESQTRV-NPRHPLLGFSKVGIFTSENKLGRSKFSFSEDPFIFSSTTLL 462 QH NFPEK +P QTR+ N RHP GFS+V IF SENKLGRS SFSEDPF FSST++ Sbjct: 32 QHSNFPEKILP---QTRIINSRHPFFGFSQVSIFNSENKLGRSNLSFSEDPFTFSSTSVA 88 Query: 463 NHTRGHATSVAE 498 H RG+ SVAE Sbjct: 89 -HFRGYG-SVAE 98 >XP_004509767.1 PREDICTED: DNA-directed RNA polymerase 1B, mitochondrial-like isoform X1 [Cicer arietinum] Length = 1002 Score = 83.2 bits (204), Expect = 2e-15 Identities = 47/72 (65%), Positives = 53/72 (73%), Gaps = 1/72 (1%) Frame = +1 Query: 286 QHPNFPEKTVPPESQTRV-NPRHPLLGFSKVGIFTSENKLGRSKFSFSEDPFIFSSTTLL 462 QH NFPEK +P QTR+ N RHP GFS+V IF SENKLGRS SFSEDPF FSST++ Sbjct: 32 QHSNFPEKILP---QTRIINSRHPFFGFSQVSIFNSENKLGRSNLSFSEDPFTFSSTSVA 88 Query: 463 NHTRGHATSVAE 498 H RG+ SVAE Sbjct: 89 -HFRGYG-SVAE 98 >XP_003628716.1 DNA-directed RNA polymerase [Medicago truncatula] AET03192.1 DNA-directed RNA polymerase [Medicago truncatula] Length = 259 Score = 65.5 bits (158), Expect = 9e-10 Identities = 40/71 (56%), Positives = 45/71 (63%) Frame = +1 Query: 286 QHPNFPEKTVPPESQTRVNPRHPLLGFSKVGIFTSENKLGRSKFSFSEDPFIFSSTTLLN 465 QH NFPEK + RHP FS+VGIFTSE KLGRS FSFSE PF FSS + LN Sbjct: 29 QH-NFPEKIL----------RHPFSRFSQVGIFTSEYKLGRSNFSFSEHPFSFSSIS-LN 76 Query: 466 HTRGHATSVAE 498 H R + + AE Sbjct: 77 HFRTYGSVAAE 87 >OIW16720.1 hypothetical protein TanjilG_14490 [Lupinus angustifolius] Length = 863 Score = 55.8 bits (133), Expect = 5e-06 Identities = 34/71 (47%), Positives = 47/71 (66%), Gaps = 1/71 (1%) Frame = +1 Query: 289 HP-NFPEKTVPPESQTRVNPRHPLLGFSKVGIFTSENKLGRSKFSFSEDPFIFSSTTLLN 465 HP NF K + ++Q+ V +P+LGF KVG+FT+ N+LGR FS SE P F S + LN Sbjct: 29 HPSNFLGKIITTQTQSHVPSTYPVLGFGKVGVFTTINELGRCNFSLSEYP--FGSYSPLN 86 Query: 466 HTRGHATSVAE 498 T+ + +SVAE Sbjct: 87 LTKCY-SSVAE 96 >XP_019429435.1 PREDICTED: DNA-directed RNA polymerase 1B, mitochondrial-like [Lupinus angustifolius] Length = 1000 Score = 55.8 bits (133), Expect = 5e-06 Identities = 34/71 (47%), Positives = 47/71 (66%), Gaps = 1/71 (1%) Frame = +1 Query: 289 HP-NFPEKTVPPESQTRVNPRHPLLGFSKVGIFTSENKLGRSKFSFSEDPFIFSSTTLLN 465 HP NF K + ++Q+ V +P+LGF KVG+FT+ N+LGR FS SE P F S + LN Sbjct: 29 HPSNFLGKIITTQTQSHVPSTYPVLGFGKVGVFTTINELGRCNFSLSEYP--FGSYSPLN 86 Query: 466 HTRGHATSVAE 498 T+ + +SVAE Sbjct: 87 LTKCY-SSVAE 96