BLASTX nr result
ID: Glycyrrhiza29_contig00038138
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza29_contig00038138 (407 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_003622982.1 hypothetical protein MTR_7g059080 [Medicago trunc... 57 2e-07 XP_013443253.1 hypothetical protein MTR_0027s0180 [Medicago trun... 57 7e-07 >XP_003622982.1 hypothetical protein MTR_7g059080 [Medicago truncatula] AES79200.1 hypothetical protein MTR_7g059080 [Medicago truncatula] Length = 173 Score = 57.0 bits (136), Expect = 2e-07 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = -3 Query: 384 SIPPAESGHITCRRKGNWITTDSEFVVLEL 295 SIP ++SGH TCRRK NWITTDSEFVVLEL Sbjct: 144 SIPSSQSGHTTCRRKANWITTDSEFVVLEL 173 >XP_013443253.1 hypothetical protein MTR_0027s0180 [Medicago truncatula] KEH17278.1 hypothetical protein MTR_0027s0180 [Medicago truncatula] Length = 457 Score = 57.0 bits (136), Expect = 7e-07 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = -3 Query: 384 SIPPAESGHITCRRKGNWITTDSEFVVLEL 295 SIP ++SGH TCRRK NWITTDSEFVVLEL Sbjct: 428 SIPSSQSGHTTCRRKANWITTDSEFVVLEL 457