BLASTX nr result
ID: Glycyrrhiza29_contig00038126
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza29_contig00038126 (219 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_004498009.1 PREDICTED: uncharacterized protein LOC101505674 [... 41 7e-07 >XP_004498009.1 PREDICTED: uncharacterized protein LOC101505674 [Cicer arietinum] Length = 343 Score = 41.2 bits (95), Expect(2) = 7e-07 Identities = 19/31 (61%), Positives = 22/31 (70%) Frame = -1 Query: 120 EFESSFVCLAKMVLNFMVEQSQSQPPPATEK 28 E E S VCLAKMV +FM EQ Q QPPP+ + Sbjct: 56 ELEPSSVCLAKMVQSFMEEQPQPQPPPSRNR 86 Score = 39.3 bits (90), Expect(2) = 7e-07 Identities = 20/32 (62%), Positives = 24/32 (75%), Gaps = 1/32 (3%) Frame = -2 Query: 218 IDPERVKKV-RIEPILKWRLKRLFAFEWQLLK 126 ID E+VK+V R EP+ KWRL+R FAFE Q K Sbjct: 11 IDSEKVKEVLRNEPVSKWRLRRFFAFEKQFPK 42