BLASTX nr result
ID: Glycyrrhiza29_contig00037966
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza29_contig00037966 (251 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KYP61652.1 Putative pentatricopeptide repeat-containing protein ... 154 2e-42 KYP36733.1 Putative pentatricopeptide repeat-containing protein ... 154 3e-42 XP_004504106.1 PREDICTED: pentatricopeptide repeat-containing pr... 152 2e-41 XP_006584019.1 PREDICTED: pentatricopeptide repeat-containing pr... 150 1e-40 KHN02948.1 Pentatricopeptide repeat-containing protein [Glycine ... 150 2e-40 XP_007146519.1 hypothetical protein PHAVU_006G0477000g, partial ... 139 3e-40 XP_016180577.1 PREDICTED: pentatricopeptide repeat-containing pr... 146 4e-39 XP_015944513.1 PREDICTED: pentatricopeptide repeat-containing pr... 146 4e-39 XP_016171777.1 PREDICTED: pentatricopeptide repeat-containing pr... 145 1e-38 XP_019420279.1 PREDICTED: pentatricopeptide repeat-containing pr... 144 1e-38 XP_013446762.1 pentatricopeptide (PPR) repeat protein [Medicago ... 140 3e-37 XP_017409314.1 PREDICTED: pentatricopeptide repeat-containing pr... 140 4e-37 XP_017409312.1 PREDICTED: pentatricopeptide repeat-containing pr... 140 4e-37 GAU19136.1 hypothetical protein TSUD_79590 [Trifolium subterraneum] 140 4e-37 XP_014517156.1 PREDICTED: pentatricopeptide repeat-containing pr... 135 3e-35 KHN41661.1 Pentatricopeptide repeat-containing protein [Glycine ... 131 2e-34 XP_015898423.1 PREDICTED: pentatricopeptide repeat-containing pr... 119 2e-29 OAY60598.1 hypothetical protein MANES_01G124700 [Manihot esculenta] 117 7e-29 EEF36190.1 pentatricopeptide repeat-containing protein, putative... 114 2e-28 KHN16630.1 Pentatricopeptide repeat-containing protein [Glycine ... 112 4e-28 >KYP61652.1 Putative pentatricopeptide repeat-containing protein At1g68930 family [Cajanus cajan] Length = 581 Score = 154 bits (388), Expect = 2e-42 Identities = 75/82 (91%), Positives = 77/82 (93%) Frame = -1 Query: 251 VYSWNALLSAYAKGGLVEDLHAVFDQMPCRDSVSYNTLIACFASNGHSSKALKVLVRMQE 72 VYSWNALLSAYAK G+VE+LH VFDQMP RDSVSYNTLIACFASNGHS KALKVLVRMQE Sbjct: 42 VYSWNALLSAYAKMGMVENLHVVFDQMPYRDSVSYNTLIACFASNGHSGKALKVLVRMQE 101 Query: 71 DGFQPTHYSYVNALQACSQLLD 6 DGFQPT YSYVNALQACSQLLD Sbjct: 102 DGFQPTQYSYVNALQACSQLLD 123 Score = 57.8 bits (138), Expect = 7e-08 Identities = 26/73 (35%), Positives = 45/73 (61%) Frame = -1 Query: 239 NALLSAYAKGGLVEDLHAVFDQMPCRDSVSYNTLIACFASNGHSSKALKVLVRMQEDGFQ 60 +AL+ Y K G+ D +F+ MP ++ +++N +I +A NG +AL + RMQE+ F+ Sbjct: 249 SALVDMYCKCGVTLDAWIIFETMPIQNVITWNAMILGYAQNGQVLEALALYERMQEEKFK 308 Query: 59 PTHYSYVNALQAC 21 P + ++V L AC Sbjct: 309 PDNITFVGVLSAC 321 >KYP36733.1 Putative pentatricopeptide repeat-containing protein At1g68930 family [Cajanus cajan] Length = 618 Score = 154 bits (388), Expect = 3e-42 Identities = 75/82 (91%), Positives = 77/82 (93%) Frame = -1 Query: 251 VYSWNALLSAYAKGGLVEDLHAVFDQMPCRDSVSYNTLIACFASNGHSSKALKVLVRMQE 72 VYSWNALLSAYAK G+VE+LH VFDQMP RDSVSYNTLIACFASNGHS KALKVLVRMQE Sbjct: 79 VYSWNALLSAYAKMGMVENLHVVFDQMPYRDSVSYNTLIACFASNGHSGKALKVLVRMQE 138 Query: 71 DGFQPTHYSYVNALQACSQLLD 6 DGFQPT YSYVNALQACSQLLD Sbjct: 139 DGFQPTQYSYVNALQACSQLLD 160 Score = 57.8 bits (138), Expect = 7e-08 Identities = 26/73 (35%), Positives = 45/73 (61%) Frame = -1 Query: 239 NALLSAYAKGGLVEDLHAVFDQMPCRDSVSYNTLIACFASNGHSSKALKVLVRMQEDGFQ 60 +AL+ Y K G+ D +F+ MP ++ +++N +I +A NG +AL + RMQE+ F+ Sbjct: 286 SALVDMYCKCGVTLDAWIIFETMPIQNVITWNAMILGYAQNGQVLEALALYERMQEEKFK 345 Query: 59 PTHYSYVNALQAC 21 P + ++V L AC Sbjct: 346 PDNITFVGVLSAC 358 >XP_004504106.1 PREDICTED: pentatricopeptide repeat-containing protein At4g02750-like [Cicer arietinum] XP_004504107.1 PREDICTED: pentatricopeptide repeat-containing protein At4g02750-like [Cicer arietinum] XP_012572223.1 PREDICTED: pentatricopeptide repeat-containing protein At4g02750-like [Cicer arietinum] Length = 699 Score = 152 bits (385), Expect = 2e-41 Identities = 76/83 (91%), Positives = 77/83 (92%) Frame = -1 Query: 251 VYSWNALLSAYAKGGLVEDLHAVFDQMPCRDSVSYNTLIACFASNGHSSKALKVLVRMQE 72 VYSWNALLS YAK GLVEDL AVFDQMPCRDSVSYNTLIACFASN SSKALK+LVRMQE Sbjct: 95 VYSWNALLSVYAKVGLVEDLCAVFDQMPCRDSVSYNTLIACFASNRLSSKALKILVRMQE 154 Query: 71 DGFQPTHYSYVNALQACSQLLDF 3 DGFQPT YSYVNALQACSQLLDF Sbjct: 155 DGFQPTQYSYVNALQACSQLLDF 177 Score = 53.9 bits (128), Expect = 2e-06 Identities = 23/73 (31%), Positives = 43/73 (58%) Frame = -1 Query: 239 NALLSAYAKGGLVEDLHAVFDQMPCRDSVSYNTLIACFASNGHSSKALKVLVRMQEDGFQ 60 +AL+ Y K G+ D +F+ MP ++ +++N +I +A NG +AL + +M ++ + Sbjct: 367 SALVDMYCKCGVPFDARIIFETMPVQNVITWNAMILGYAQNGQGQQALALYEKMLQENLK 426 Query: 59 PTHYSYVNALQAC 21 P + S+V L AC Sbjct: 427 PDNISFVGVLSAC 439 >XP_006584019.1 PREDICTED: pentatricopeptide repeat-containing protein At2g22070-like [Glycine max] XP_014633706.1 PREDICTED: pentatricopeptide repeat-containing protein At2g22070-like [Glycine max] XP_014633707.1 PREDICTED: pentatricopeptide repeat-containing protein At2g22070-like [Glycine max] XP_014633708.1 PREDICTED: pentatricopeptide repeat-containing protein At2g22070-like [Glycine max] KRH50811.1 hypothetical protein GLYMA_07G245500 [Glycine max] Length = 693 Score = 150 bits (379), Expect = 1e-40 Identities = 73/82 (89%), Positives = 76/82 (92%) Frame = -1 Query: 251 VYSWNALLSAYAKGGLVEDLHAVFDQMPCRDSVSYNTLIACFASNGHSSKALKVLVRMQE 72 VYSWN LLSAYAK G+VE+LH VFDQMP RDSVSYNTLIACFASNGHS KALKVLVRMQE Sbjct: 89 VYSWNTLLSAYAKMGMVENLHVVFDQMPYRDSVSYNTLIACFASNGHSGKALKVLVRMQE 148 Query: 71 DGFQPTHYSYVNALQACSQLLD 6 DGFQPT YS+VNALQACSQLLD Sbjct: 149 DGFQPTQYSHVNALQACSQLLD 170 Score = 60.1 bits (144), Expect = 1e-08 Identities = 26/73 (35%), Positives = 45/73 (61%) Frame = -1 Query: 239 NALLSAYAKGGLVEDLHAVFDQMPCRDSVSYNTLIACFASNGHSSKALKVLVRMQEDGFQ 60 +AL+ Y K G+ D +F+ MP R+ +++N +I +A NG +AL + RMQ++ F+ Sbjct: 361 SALVDMYCKCGVTLDARVIFETMPIRNVITWNAMILGYAQNGQVLEALTLYERMQQENFK 420 Query: 59 PTHYSYVNALQAC 21 P + ++V L AC Sbjct: 421 PDNITFVGVLSAC 433 >KHN02948.1 Pentatricopeptide repeat-containing protein [Glycine soja] Length = 841 Score = 150 bits (379), Expect = 2e-40 Identities = 73/82 (89%), Positives = 76/82 (92%) Frame = -1 Query: 251 VYSWNALLSAYAKGGLVEDLHAVFDQMPCRDSVSYNTLIACFASNGHSSKALKVLVRMQE 72 VYSWN LLSAYAK G+VE+LH VFDQMP RDSVSYNTLIACFASNGHS KALKVLVRMQE Sbjct: 89 VYSWNTLLSAYAKMGMVENLHVVFDQMPYRDSVSYNTLIACFASNGHSGKALKVLVRMQE 148 Query: 71 DGFQPTHYSYVNALQACSQLLD 6 DGFQPT YS+VNALQACSQLLD Sbjct: 149 DGFQPTQYSHVNALQACSQLLD 170 Score = 60.1 bits (144), Expect = 1e-08 Identities = 26/73 (35%), Positives = 45/73 (61%) Frame = -1 Query: 239 NALLSAYAKGGLVEDLHAVFDQMPCRDSVSYNTLIACFASNGHSSKALKVLVRMQEDGFQ 60 +AL+ Y K G+ D +F+ MP R+ +++N +I +A NG +AL + RMQ++ F+ Sbjct: 361 SALVDMYCKCGVTLDARVIFETMPIRNVITWNAMILGYAQNGQVLEALTLYERMQQENFK 420 Query: 59 PTHYSYVNALQAC 21 P + ++V L AC Sbjct: 421 PDNITFVGVLSAC 433 >XP_007146519.1 hypothetical protein PHAVU_006G0477000g, partial [Phaseolus vulgaris] ESW18513.1 hypothetical protein PHAVU_006G0477000g, partial [Phaseolus vulgaris] Length = 184 Score = 139 bits (350), Expect = 3e-40 Identities = 67/82 (81%), Positives = 75/82 (91%) Frame = -1 Query: 251 VYSWNALLSAYAKGGLVEDLHAVFDQMPCRDSVSYNTLIACFASNGHSSKALKVLVRMQE 72 VYSWNALLSAYAK +VE LH VFDQMP RDS+SYNTLIA FA+NG+S KAL+VL+RMQE Sbjct: 89 VYSWNALLSAYAKMDMVEKLHVVFDQMPYRDSISYNTLIAYFANNGNSGKALRVLMRMQE 148 Query: 71 DGFQPTHYSYVNALQACSQLLD 6 +GFQPTH+SYVNALQACSQLLD Sbjct: 149 EGFQPTHHSYVNALQACSQLLD 170 >XP_016180577.1 PREDICTED: pentatricopeptide repeat-containing protein At2g22070-like [Arachis ipaensis] XP_016180578.1 PREDICTED: pentatricopeptide repeat-containing protein At2g22070-like [Arachis ipaensis] XP_016180579.1 PREDICTED: pentatricopeptide repeat-containing protein At2g22070-like [Arachis ipaensis] XP_016180580.1 PREDICTED: pentatricopeptide repeat-containing protein At2g22070-like [Arachis ipaensis] XP_016180581.1 PREDICTED: pentatricopeptide repeat-containing protein At2g22070-like [Arachis ipaensis] XP_016180582.1 PREDICTED: pentatricopeptide repeat-containing protein At2g22070-like [Arachis ipaensis] Length = 693 Score = 146 bits (368), Expect = 4e-39 Identities = 72/82 (87%), Positives = 74/82 (90%) Frame = -1 Query: 251 VYSWNALLSAYAKGGLVEDLHAVFDQMPCRDSVSYNTLIACFASNGHSSKALKVLVRMQE 72 VYSWNALLSAYAK GLVEDL VFDQMP RDSVSYNTLIACFA+ GHS KALK+LVRMQE Sbjct: 88 VYSWNALLSAYAKLGLVEDLCTVFDQMPSRDSVSYNTLIACFATTGHSGKALKILVRMQE 147 Query: 71 DGFQPTHYSYVNALQACSQLLD 6 DGFQPT YSYVNALQACS LLD Sbjct: 148 DGFQPTQYSYVNALQACSTLLD 169 Score = 52.8 bits (125), Expect = 4e-06 Identities = 25/73 (34%), Positives = 43/73 (58%) Frame = -1 Query: 239 NALLSAYAKGGLVEDLHAVFDQMPCRDSVSYNTLIACFASNGHSSKALKVLVRMQEDGFQ 60 +AL+ Y K G+ D ++F MP R+ +++N++I +A NG +AL + RM ++ + Sbjct: 360 SALVDMYCKCGVTLDAWSIFWIMPIRNVITWNSMIHGYAQNGQPHEALALYERMLQENIK 419 Query: 59 PTHYSYVNALQAC 21 P S+V L AC Sbjct: 420 PDSISFVGVLSAC 432 >XP_015944513.1 PREDICTED: pentatricopeptide repeat-containing protein At2g01510, mitochondrial-like [Arachis duranensis] XP_015944514.1 PREDICTED: pentatricopeptide repeat-containing protein At2g01510, mitochondrial-like [Arachis duranensis] XP_015944515.1 PREDICTED: pentatricopeptide repeat-containing protein At2g01510, mitochondrial-like [Arachis duranensis] Length = 693 Score = 146 bits (368), Expect = 4e-39 Identities = 72/82 (87%), Positives = 75/82 (91%) Frame = -1 Query: 251 VYSWNALLSAYAKGGLVEDLHAVFDQMPCRDSVSYNTLIACFASNGHSSKALKVLVRMQE 72 VYSWNALLSAYAK GLVEDL VFDQMP DSVSYNTLIACFA+NGHS KALK+LVRMQE Sbjct: 88 VYSWNALLSAYAKLGLVEDLCTVFDQMPSCDSVSYNTLIACFATNGHSGKALKILVRMQE 147 Query: 71 DGFQPTHYSYVNALQACSQLLD 6 DGFQPT YSYVNALQACS+LLD Sbjct: 148 DGFQPTQYSYVNALQACSKLLD 169 >XP_016171777.1 PREDICTED: pentatricopeptide repeat-containing protein At4g14050, mitochondrial-like [Arachis ipaensis] Length = 726 Score = 145 bits (365), Expect = 1e-38 Identities = 72/82 (87%), Positives = 74/82 (90%) Frame = -1 Query: 251 VYSWNALLSAYAKGGLVEDLHAVFDQMPCRDSVSYNTLIACFASNGHSSKALKVLVRMQE 72 VYSWNALLSAYAK GLVEDL VFDQMP RDSVSYNTLIACFA+NGHS KALK+LVRMQE Sbjct: 121 VYSWNALLSAYAKLGLVEDLCTVFDQMPVRDSVSYNTLIACFATNGHSGKALKILVRMQE 180 Query: 71 DGFQPTHYSYVNALQACSQLLD 6 DGFQ T YSYVNALQACS LLD Sbjct: 181 DGFQLTQYSYVNALQACSMLLD 202 >XP_019420279.1 PREDICTED: pentatricopeptide repeat-containing protein At2g22070-like [Lupinus angustifolius] XP_019420280.1 PREDICTED: pentatricopeptide repeat-containing protein At2g22070-like [Lupinus angustifolius] OIV94289.1 hypothetical protein TanjilG_00038 [Lupinus angustifolius] Length = 694 Score = 144 bits (364), Expect = 1e-38 Identities = 71/83 (85%), Positives = 76/83 (91%) Frame = -1 Query: 251 VYSWNALLSAYAKGGLVEDLHAVFDQMPCRDSVSYNTLIACFASNGHSSKALKVLVRMQE 72 VYSWNALLSAYAK G+VEDLHAVF QMP RDSVSYNTLIACF+S G+S KAL+VLV MQE Sbjct: 89 VYSWNALLSAYAKVGMVEDLHAVFCQMPYRDSVSYNTLIACFSSKGYSCKALRVLVMMQE 148 Query: 71 DGFQPTHYSYVNALQACSQLLDF 3 DGFQPT +SYVNALQACSQLLDF Sbjct: 149 DGFQPTQHSYVNALQACSQLLDF 171 Score = 53.5 bits (127), Expect = 2e-06 Identities = 25/73 (34%), Positives = 42/73 (57%) Frame = -1 Query: 239 NALLSAYAKGGLVEDLHAVFDQMPCRDSVSYNTLIACFASNGHSSKALKVLVRMQEDGFQ 60 +AL+ Y K G+ D +F MP R+ +++N +I +A NG +AL + RM ++ F+ Sbjct: 361 SALVDMYCKCGVTLDAWVIFQTMPVRNVITWNAMIRGYAQNGQVQEALVLYERMLQENFR 420 Query: 59 PTHYSYVNALQAC 21 + S+V L AC Sbjct: 421 ADNISFVAVLSAC 433 >XP_013446762.1 pentatricopeptide (PPR) repeat protein [Medicago truncatula] KEH20789.1 pentatricopeptide (PPR) repeat protein [Medicago truncatula] Length = 701 Score = 140 bits (354), Expect = 3e-37 Identities = 68/83 (81%), Positives = 74/83 (89%) Frame = -1 Query: 251 VYSWNALLSAYAKGGLVEDLHAVFDQMPCRDSVSYNTLIACFASNGHSSKALKVLVRMQE 72 +YSWNALLSAYAK GLVEDL+ VFD+M CRDSVSYNT+IACFASN S KAL+ VRMQE Sbjct: 97 IYSWNALLSAYAKVGLVEDLNLVFDRMACRDSVSYNTMIACFASNWLSGKALRFFVRMQE 156 Query: 71 DGFQPTHYSYVNALQACSQLLDF 3 DGF+PT YSYVNALQACSQLLDF Sbjct: 157 DGFRPTQYSYVNALQACSQLLDF 179 Score = 57.8 bits (138), Expect = 7e-08 Identities = 25/73 (34%), Positives = 45/73 (61%) Frame = -1 Query: 239 NALLSAYAKGGLVEDLHAVFDQMPCRDSVSYNTLIACFASNGHSSKALKVLVRMQEDGFQ 60 +AL+ Y K G+ D +F+ MP ++ + +N++I +A NG + +AL + RM ++ F+ Sbjct: 369 SALVDMYCKCGVPLDARVIFETMPIKNVIIWNSMILGYAQNGEAEEALTLYERMLQENFK 428 Query: 59 PTHYSYVNALQAC 21 P + S+V L AC Sbjct: 429 PDNISFVGVLSAC 441 >XP_017409314.1 PREDICTED: pentatricopeptide repeat-containing protein At5g04780-like isoform X2 [Vigna angularis] Length = 730 Score = 140 bits (354), Expect = 4e-37 Identities = 68/82 (82%), Positives = 73/82 (89%) Frame = -1 Query: 251 VYSWNALLSAYAKGGLVEDLHAVFDQMPCRDSVSYNTLIACFASNGHSSKALKVLVRMQE 72 VYSWNALLSAYAK G E+LH VFDQMP RDS+SYNTLIA FASNGHS KAL+VL RMQE Sbjct: 126 VYSWNALLSAYAKMGTAENLHVVFDQMPYRDSISYNTLIAYFASNGHSGKALEVLTRMQE 185 Query: 71 DGFQPTHYSYVNALQACSQLLD 6 +GFQPTH+SYV ALQACSQLLD Sbjct: 186 EGFQPTHHSYVKALQACSQLLD 207 Score = 57.0 bits (136), Expect = 1e-07 Identities = 27/73 (36%), Positives = 44/73 (60%) Frame = -1 Query: 239 NALLSAYAKGGLVEDLHAVFDQMPCRDSVSYNTLIACFASNGHSSKALKVLVRMQEDGFQ 60 +AL+ Y+K G+ VF+ MP R+ V++N +I +A NG +AL + RMQ++ F+ Sbjct: 398 SALVDMYSKCGITLAAWVVFETMPIRNVVTWNAMILGYAQNGQVPEALALFERMQQENFK 457 Query: 59 PTHYSYVNALQAC 21 P ++V L AC Sbjct: 458 PDSITFVAVLSAC 470 >XP_017409312.1 PREDICTED: pentatricopeptide repeat-containing protein At5g04780-like isoform X1 [Vigna angularis] XP_017409313.1 PREDICTED: pentatricopeptide repeat-containing protein At5g04780-like isoform X1 [Vigna angularis] Length = 736 Score = 140 bits (354), Expect = 4e-37 Identities = 68/82 (82%), Positives = 73/82 (89%) Frame = -1 Query: 251 VYSWNALLSAYAKGGLVEDLHAVFDQMPCRDSVSYNTLIACFASNGHSSKALKVLVRMQE 72 VYSWNALLSAYAK G E+LH VFDQMP RDS+SYNTLIA FASNGHS KAL+VL RMQE Sbjct: 132 VYSWNALLSAYAKMGTAENLHVVFDQMPYRDSISYNTLIAYFASNGHSGKALEVLTRMQE 191 Query: 71 DGFQPTHYSYVNALQACSQLLD 6 +GFQPTH+SYV ALQACSQLLD Sbjct: 192 EGFQPTHHSYVKALQACSQLLD 213 Score = 57.0 bits (136), Expect = 1e-07 Identities = 27/73 (36%), Positives = 44/73 (60%) Frame = -1 Query: 239 NALLSAYAKGGLVEDLHAVFDQMPCRDSVSYNTLIACFASNGHSSKALKVLVRMQEDGFQ 60 +AL+ Y+K G+ VF+ MP R+ V++N +I +A NG +AL + RMQ++ F+ Sbjct: 404 SALVDMYSKCGITLAAWVVFETMPIRNVVTWNAMILGYAQNGQVPEALALFERMQQENFK 463 Query: 59 PTHYSYVNALQAC 21 P ++V L AC Sbjct: 464 PDSITFVAVLSAC 476 >GAU19136.1 hypothetical protein TSUD_79590 [Trifolium subterraneum] Length = 747 Score = 140 bits (354), Expect = 4e-37 Identities = 71/83 (85%), Positives = 73/83 (87%) Frame = -1 Query: 251 VYSWNALLSAYAKGGLVEDLHAVFDQMPCRDSVSYNTLIACFASNGHSSKALKVLVRMQE 72 VYSWNALLSAYAK G VEDL+ VFDQMPCRDSVSYNTLIA FASN SSKAL VRMQE Sbjct: 89 VYSWNALLSAYAKVGSVEDLNVVFDQMPCRDSVSYNTLIAYFASNRLSSKALSFFVRMQE 148 Query: 71 DGFQPTHYSYVNALQACSQLLDF 3 +GFQPT YSYVNALQACSQLLDF Sbjct: 149 NGFQPTQYSYVNALQACSQLLDF 171 Score = 57.0 bits (136), Expect = 1e-07 Identities = 25/73 (34%), Positives = 45/73 (61%) Frame = -1 Query: 239 NALLSAYAKGGLVEDLHAVFDQMPCRDSVSYNTLIACFASNGHSSKALKVLVRMQEDGFQ 60 +AL+ Y K G+ D +F+ M R+ +++N++I +A NG + +AL + RM ++ F+ Sbjct: 361 SALVDMYGKCGVPFDARVIFETMSIRNVITWNSMILGYAQNGEAQEALALYERMLQENFK 420 Query: 59 PTHYSYVNALQAC 21 P + S+V L AC Sbjct: 421 PDNISFVGVLSAC 433 >XP_014517156.1 PREDICTED: pentatricopeptide repeat-containing protein At5g04780-like [Vigna radiata var. radiata] Length = 693 Score = 135 bits (340), Expect = 3e-35 Identities = 65/82 (79%), Positives = 75/82 (91%) Frame = -1 Query: 251 VYSWNALLSAYAKGGLVEDLHAVFDQMPCRDSVSYNTLIACFASNGHSSKALKVLVRMQE 72 VYSWNALLSAYAK G+VE+L+ VFD+MP R+S+SYN LIA FASNGHS KAL+VL+RMQE Sbjct: 89 VYSWNALLSAYAKMGMVENLNVVFDRMPYRNSISYNKLIAYFASNGHSGKALEVLMRMQE 148 Query: 71 DGFQPTHYSYVNALQACSQLLD 6 +GFQPTH+SYV ALQACSQLLD Sbjct: 149 EGFQPTHHSYVKALQACSQLLD 170 Score = 60.1 bits (144), Expect = 1e-08 Identities = 27/73 (36%), Positives = 46/73 (63%) Frame = -1 Query: 239 NALLSAYAKGGLVEDLHAVFDQMPCRDSVSYNTLIACFASNGHSSKALKVLVRMQEDGFQ 60 +AL+ Y+K G+ D VF+ MP R+ +++N +I +A NG +AL + RMQ++ F+ Sbjct: 361 SALVDMYSKCGITLDAWVVFETMPIRNVITWNAMILGYAQNGQVPEALALYERMQQENFK 420 Query: 59 PTHYSYVNALQAC 21 P + ++V L AC Sbjct: 421 PDNITFVAVLSAC 433 >KHN41661.1 Pentatricopeptide repeat-containing protein [Glycine soja] Length = 514 Score = 131 bits (330), Expect = 2e-34 Identities = 64/80 (80%), Positives = 69/80 (86%) Frame = -1 Query: 251 VYSWNALLSAYAKGGLVEDLHAVFDQMPCRDSVSYNTLIACFASNGHSSKALKVLVRMQE 72 VYSWN LLSAYAK G+VE+LH VFDQMP DSVSYNTLIACFASNGHS KALK LVRMQE Sbjct: 6 VYSWNDLLSAYAKMGMVENLHVVFDQMPYCDSVSYNTLIACFASNGHSGKALKALVRMQE 65 Query: 71 DGFQPTHYSYVNALQACSQL 12 DGFQPT YS+VNAL A + + Sbjct: 66 DGFQPTQYSHVNALNAMTDM 85 Score = 60.1 bits (144), Expect = 1e-08 Identities = 27/73 (36%), Positives = 44/73 (60%) Frame = -1 Query: 239 NALLSAYAKGGLVEDLHAVFDQMPCRDSVSYNTLIACFASNGHSSKALKVLVRMQEDGFQ 60 +AL+ Y K G+ D +F+ MP R+ +++N LI +A NG +AL + RMQ+ F+ Sbjct: 182 SALVDMYCKCGVTLDARVIFETMPIRNVITWNALILGYAQNGQVLEALTLYERMQQQNFK 241 Query: 59 PTHYSYVNALQAC 21 P + ++V L AC Sbjct: 242 PDNITFVGVLSAC 254 >XP_015898423.1 PREDICTED: pentatricopeptide repeat-containing protein At3g62890-like [Ziziphus jujuba] Length = 695 Score = 119 bits (297), Expect = 2e-29 Identities = 57/83 (68%), Positives = 69/83 (83%) Frame = -1 Query: 251 VYSWNALLSAYAKGGLVEDLHAVFDQMPCRDSVSYNTLIACFASNGHSSKALKVLVRMQE 72 V+SWNA+LSAYAK G V DL A FDQMP RD VSYNT+IA FA NG SS+AL+V +RMQE Sbjct: 89 VFSWNAMLSAYAKSGSVRDLGATFDQMPYRDLVSYNTMIAGFAGNGCSSEALQVFLRMQE 148 Query: 71 DGFQPTHYSYVNALQACSQLLDF 3 +G +P+ Y++V+ LQACSQLLDF Sbjct: 149 EGLEPSEYTFVSLLQACSQLLDF 171 Score = 55.8 bits (133), Expect = 3e-07 Identities = 26/73 (35%), Positives = 41/73 (56%) Frame = -1 Query: 239 NALLSAYAKGGLVEDLHAVFDQMPCRDSVSYNTLIACFASNGHSSKALKVLVRMQEDGFQ 60 +AL+ Y K G+ D VF MP R+ VS+N +I +A NG +AL + M ++ + Sbjct: 361 SALVDMYCKCGVTSDAWEVFKMMPSRNVVSWNAMIGGYAQNGQDIQALTLYESMMQENMK 420 Query: 59 PTHYSYVNALQAC 21 P + ++V L AC Sbjct: 421 PDNVTFVGVLSAC 433 Score = 52.4 bits (124), Expect = 6e-06 Identities = 26/76 (34%), Positives = 42/76 (55%) Frame = -1 Query: 251 VYSWNALLSAYAKGGLVEDLHAVFDQMPCRDSVSYNTLIACFASNGHSSKALKVLVRMQE 72 V+ WNAL + YAK G ++ +FDQ+ ++ VS+N++I+ + NG K + +MQ Sbjct: 190 VFIWNALTNMYAKCGDIDRAQWLFDQLVDKNLVSWNSIISGYLINGQPDKCIDFFHKMQL 249 Query: 71 DGFQPTHYSYVNALQA 24 G P + N L A Sbjct: 250 SGLNPDQVTLSNVLTA 265 >OAY60598.1 hypothetical protein MANES_01G124700 [Manihot esculenta] Length = 694 Score = 117 bits (293), Expect = 7e-29 Identities = 54/82 (65%), Positives = 68/82 (82%) Frame = -1 Query: 251 VYSWNALLSAYAKGGLVEDLHAVFDQMPCRDSVSYNTLIACFASNGHSSKALKVLVRMQE 72 V+SWNA+LS YAK GL+EDL AVFD MP RDSVSYNT+I+ FA NG +SKA++ VRMQ Sbjct: 90 VFSWNAMLSLYAKSGLIEDLRAVFDNMPSRDSVSYNTVISGFAKNGCASKAVEAFVRMQN 149 Query: 71 DGFQPTHYSYVNALQACSQLLD 6 +GF+PT Y++V+ L AC+QLLD Sbjct: 150 EGFKPTEYTHVSVLNACAQLLD 171 Score = 57.4 bits (137), Expect = 1e-07 Identities = 28/73 (38%), Positives = 43/73 (58%) Frame = -1 Query: 239 NALLSAYAKGGLVEDLHAVFDQMPCRDSVSYNTLIACFASNGHSSKALKVLVRMQEDGFQ 60 +AL+ Y K G+ D VF+ MP R+ VS+N +I +A NG S+AL + M ++ + Sbjct: 362 SALVDMYCKCGVTADAWIVFNTMPTRNVVSWNAMIRGYAQNGQDSEALALYENMLQEDTR 421 Query: 59 PTHYSYVNALQAC 21 P + +YV L AC Sbjct: 422 PDNVTYVGILSAC 434 >EEF36190.1 pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 446 Score = 114 bits (286), Expect = 2e-28 Identities = 52/82 (63%), Positives = 65/82 (79%) Frame = -1 Query: 251 VYSWNALLSAYAKGGLVEDLHAVFDQMPCRDSVSYNTLIACFASNGHSSKALKVLVRMQE 72 ++SWNA+LS YAK GLVEDL VFD MP RDSVSYNT+I FA NG + KA++ VRMQ Sbjct: 90 IFSWNAMLSLYAKAGLVEDLRVVFDDMPSRDSVSYNTVITGFAKNGRAGKAVEAFVRMQT 149 Query: 71 DGFQPTHYSYVNALQACSQLLD 6 +GF+PT Y++V+ L AC+QLLD Sbjct: 150 EGFKPTEYTHVSVLNACTQLLD 171 Score = 54.3 bits (129), Expect = 1e-06 Identities = 24/73 (32%), Positives = 41/73 (56%) Frame = -1 Query: 236 ALLSAYAKGGLVEDLHAVFDQMPCRDSVSYNTLIACFASNGHSSKALKVLVRMQEDGFQP 57 +L+ Y K G+ D VF MP R VS+N ++ +A NG +AL + +M ++ +P Sbjct: 363 SLVDMYCKCGVTSDAWVVFSMMPARSVVSWNAMLGGYARNGQDLEALALYEKMFQENIRP 422 Query: 56 THYSYVNALQACS 18 + ++V L AC+ Sbjct: 423 DNITFVGVLSACN 435 >KHN16630.1 Pentatricopeptide repeat-containing protein [Glycine soja] Length = 369 Score = 112 bits (281), Expect = 4e-28 Identities = 55/64 (85%), Positives = 57/64 (89%) Frame = -1 Query: 251 VYSWNALLSAYAKGGLVEDLHAVFDQMPCRDSVSYNTLIACFASNGHSSKALKVLVRMQE 72 VYSWNALLSAYAK G+VE+L VFDQMPC SVSYNTLIACFASNGHS ALKVLVRMQE Sbjct: 111 VYSWNALLSAYAKMGMVENLRVVFDQMPCYYSVSYNTLIACFASNGHSGNALKVLVRMQE 170 Query: 71 DGFQ 60 DGFQ Sbjct: 171 DGFQ 174