BLASTX nr result
ID: Glycyrrhiza29_contig00037885
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza29_contig00037885 (229 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_004505100.1 PREDICTED: FHA domain-containing protein At4g1449... 52 7e-06 >XP_004505100.1 PREDICTED: FHA domain-containing protein At4g14490-like [Cicer arietinum] Length = 429 Score = 51.6 bits (122), Expect = 7e-06 Identities = 34/73 (46%), Positives = 41/73 (56%), Gaps = 15/73 (20%) Frame = +3 Query: 54 VQIQGIDENASVN---ESGHVDRPAPARVTRNSKNTRSAND------------DEKVEGP 188 V + IDEN++ N ES +V RP RVTRNS+N RS +EKVE P Sbjct: 142 VPVHSIDENSTFNAGDESSYVVRPESVRVTRNSRNARSGVKVSDSVVGNLNVLEEKVEEP 201 Query: 189 ENNTRVTRNLKNK 227 + NTR RNLKNK Sbjct: 202 K-NTRAKRNLKNK 213