BLASTX nr result
ID: Glycyrrhiza29_contig00037756
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza29_contig00037756 (200 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_003549125.1 PREDICTED: pentatricopeptide repeat-containing pr... 116 6e-29 XP_016200203.1 PREDICTED: pentatricopeptide repeat-containing pr... 109 1e-28 XP_015945494.1 PREDICTED: pentatricopeptide repeat-containing pr... 115 2e-28 XP_016163962.1 PREDICTED: pentatricopeptide repeat-containing pr... 107 2e-28 KYP42429.1 hypothetical protein KK1_036175 [Cajanus cajan] 110 2e-28 XP_016200145.1 PREDICTED: pentatricopeptide repeat-containing pr... 112 4e-28 XP_004512723.1 PREDICTED: pentatricopeptide repeat-containing pr... 114 4e-28 XP_015966947.1 PREDICTED: pentatricopeptide repeat-containing pr... 113 6e-28 XP_015966946.1 PREDICTED: pentatricopeptide repeat-containing pr... 113 8e-28 XP_015966945.1 PREDICTED: pentatricopeptide repeat-containing pr... 113 8e-28 XP_015966877.1 PREDICTED: pentatricopeptide repeat-containing pr... 112 2e-27 XP_016177672.1 PREDICTED: pentatricopeptide repeat-containing pr... 112 2e-27 KRH39060.1 hypothetical protein GLYMA_09G175400 [Glycine max] 106 2e-27 XP_016203409.1 PREDICTED: pentatricopeptide repeat-containing pr... 109 2e-27 XP_016203501.1 PREDICTED: pentatricopeptide repeat-containing pr... 111 3e-27 XP_013452887.1 pentatricopeptide (PPR) repeat protein [Medicago ... 102 4e-27 XP_016203414.1 PREDICTED: pentatricopeptide repeat-containing pr... 108 4e-27 KHN32591.1 Putative pentatricopeptide repeat-containing protein,... 110 4e-27 XP_016165834.1 PREDICTED: pentatricopeptide repeat-containing pr... 110 8e-27 XP_015966952.1 PREDICTED: putative pentatricopeptide repeat-cont... 110 8e-27 >XP_003549125.1 PREDICTED: pentatricopeptide repeat-containing protein At1g62930, chloroplastic-like [Glycine max] XP_014624499.1 PREDICTED: pentatricopeptide repeat-containing protein At1g62930, chloroplastic-like [Glycine max] KHN31545.1 Pentatricopeptide repeat-containing protein, chloroplastic [Glycine soja] KRH09154.1 hypothetical protein GLYMA_16G199700 [Glycine max] Length = 556 Score = 116 bits (290), Expect = 6e-29 Identities = 54/66 (81%), Positives = 61/66 (92%) Frame = -2 Query: 199 LIKGYHLNVRTYTVMINGLCKEGLFDEALALLSKMEDNGCIPNVVTYEIIILALFEKGEN 20 LIKGYHL++RTYTVMI+G CK GLFDEALALLSKMEDNGCIPN +T++III ALFEK EN Sbjct: 481 LIKGYHLDIRTYTVMISGFCKAGLFDEALALLSKMEDNGCIPNAITFDIIICALFEKDEN 540 Query: 19 EKAEKL 2 +KAEKL Sbjct: 541 DKAEKL 546 >XP_016200203.1 PREDICTED: pentatricopeptide repeat-containing protein At1g62930, chloroplastic-like [Arachis ipaensis] Length = 205 Score = 109 bits (273), Expect = 1e-28 Identities = 51/65 (78%), Positives = 59/65 (90%) Frame = -2 Query: 196 IKGYHLNVRTYTVMINGLCKEGLFDEALALLSKMEDNGCIPNVVTYEIIILALFEKGENE 17 IK + NVRTYT+MINGLCKEGLF+EALALLS+MEDNGC+PN VT+EI+I ALFEKGEN+ Sbjct: 73 IKNHRPNVRTYTIMINGLCKEGLFEEALALLSEMEDNGCLPNAVTFEIVIRALFEKGEND 132 Query: 16 KAEKL 2 AEKL Sbjct: 133 MAEKL 137 >XP_015945494.1 PREDICTED: pentatricopeptide repeat-containing protein At1g62930, chloroplastic-like [Arachis duranensis] Length = 536 Score = 115 bits (287), Expect = 2e-28 Identities = 52/65 (80%), Positives = 60/65 (92%) Frame = -2 Query: 196 IKGYHLNVRTYTVMINGLCKEGLFDEALALLSKMEDNGCIPNVVTYEIIILALFEKGENE 17 +K YH NVRTYT+MINGLCKEGLF+EALAL+SKMEDNGC+PN VT+EI+I ALFEKGEN+ Sbjct: 460 VKNYHPNVRTYTIMINGLCKEGLFEEALALMSKMEDNGCLPNAVTFEIVIRALFEKGEND 519 Query: 16 KAEKL 2 AEKL Sbjct: 520 MAEKL 524 >XP_016163962.1 PREDICTED: pentatricopeptide repeat-containing protein At1g62930, chloroplastic-like [Arachis ipaensis] Length = 127 Score = 107 bits (266), Expect = 2e-28 Identities = 51/65 (78%), Positives = 57/65 (87%) Frame = -2 Query: 196 IKGYHLNVRTYTVMINGLCKEGLFDEALALLSKMEDNGCIPNVVTYEIIILALFEKGENE 17 IKGY +V+TYT+MINGLCKEGL EALA LSKMEDNGC+P+ VTYEIII ALFEKGEN+ Sbjct: 51 IKGYRPDVKTYTIMINGLCKEGLLHEALAFLSKMEDNGCLPDAVTYEIIIGALFEKGEND 110 Query: 16 KAEKL 2 AEKL Sbjct: 111 NAEKL 115 >KYP42429.1 hypothetical protein KK1_036175 [Cajanus cajan] Length = 246 Score = 110 bits (274), Expect = 2e-28 Identities = 54/66 (81%), Positives = 58/66 (87%) Frame = -2 Query: 199 LIKGYHLNVRTYTVMINGLCKEGLFDEALALLSKMEDNGCIPNVVTYEIIILALFEKGEN 20 LIKGYHLNV TY VMI+GLCKEGLFDEALA+ SKMEDNGCIPNVVT+E II ALFE E Sbjct: 171 LIKGYHLNVWTYNVMISGLCKEGLFDEALAMKSKMEDNGCIPNVVTFERIICALFETDEK 230 Query: 19 EKAEKL 2 +KAEKL Sbjct: 231 DKAEKL 236 >XP_016200145.1 PREDICTED: pentatricopeptide repeat-containing protein At1g62930, chloroplastic-like [Arachis ipaensis] Length = 385 Score = 112 bits (280), Expect = 4e-28 Identities = 52/65 (80%), Positives = 59/65 (90%) Frame = -2 Query: 196 IKGYHLNVRTYTVMINGLCKEGLFDEALALLSKMEDNGCIPNVVTYEIIILALFEKGENE 17 IK Y NVRTYT+MINGLCKEGLF+EALAL+SKMEDNGC+PN VT+EI+I ALFEKGEN+ Sbjct: 309 IKSYRPNVRTYTIMINGLCKEGLFEEALALMSKMEDNGCLPNAVTFEIVIRALFEKGEND 368 Query: 16 KAEKL 2 AEKL Sbjct: 369 MAEKL 373 >XP_004512723.1 PREDICTED: pentatricopeptide repeat-containing protein At1g62670, mitochondrial-like [Cicer arietinum] XP_012574713.1 PREDICTED: pentatricopeptide repeat-containing protein At1g62670, mitochondrial-like [Cicer arietinum] Length = 547 Score = 114 bits (284), Expect = 4e-28 Identities = 54/66 (81%), Positives = 61/66 (92%) Frame = -2 Query: 199 LIKGYHLNVRTYTVMINGLCKEGLFDEALALLSKMEDNGCIPNVVTYEIIILALFEKGEN 20 LIKGYHL+V TYTVMI+GLCKEGLFDE LALLSKMEDNGCIP+ +TYEI+ILALFEKG+ Sbjct: 472 LIKGYHLDVLTYTVMISGLCKEGLFDEVLALLSKMEDNGCIPDAITYEIVILALFEKGKI 531 Query: 19 EKAEKL 2 + AEKL Sbjct: 532 DMAEKL 537 >XP_015966947.1 PREDICTED: pentatricopeptide repeat-containing protein At1g62670, mitochondrial-like isoform X3 [Arachis duranensis] Length = 499 Score = 113 bits (282), Expect = 6e-28 Identities = 51/65 (78%), Positives = 59/65 (90%) Frame = -2 Query: 196 IKGYHLNVRTYTVMINGLCKEGLFDEALALLSKMEDNGCIPNVVTYEIIILALFEKGENE 17 IK YH NVRTYT+MING+C EGLF+EALAL+SKMEDNGC+PN VT+EI+I ALFEKGEN+ Sbjct: 423 IKNYHKNVRTYTIMINGICNEGLFEEALALMSKMEDNGCLPNAVTFEIVIRALFEKGEND 482 Query: 16 KAEKL 2 AEKL Sbjct: 483 MAEKL 487 Score = 54.3 bits (129), Expect = 6e-07 Identities = 25/59 (42%), Positives = 36/59 (61%) Frame = -2 Query: 178 NVRTYTVMINGLCKEGLFDEALALLSKMEDNGCIPNVVTYEIIILALFEKGENEKAEKL 2 N+R+Y +M+NGLCK L DEA +LL +M+ +PN +TY +I L + A KL Sbjct: 289 NIRSYNIMVNGLCKIKLVDEAASLLEEMQRKNLVPNTITYNTLIDGLCKSKRISCASKL 347 >XP_015966946.1 PREDICTED: pentatricopeptide repeat-containing protein At1g62930, chloroplastic-like isoform X2 [Arachis duranensis] Length = 551 Score = 113 bits (282), Expect = 8e-28 Identities = 51/65 (78%), Positives = 59/65 (90%) Frame = -2 Query: 196 IKGYHLNVRTYTVMINGLCKEGLFDEALALLSKMEDNGCIPNVVTYEIIILALFEKGENE 17 IK YH NVRTYT+MING+C EGLF+EALAL+SKMEDNGC+PN VT+EI+I ALFEKGEN+ Sbjct: 475 IKNYHKNVRTYTIMINGICNEGLFEEALALMSKMEDNGCLPNAVTFEIVIRALFEKGEND 534 Query: 16 KAEKL 2 AEKL Sbjct: 535 MAEKL 539 Score = 54.3 bits (129), Expect = 6e-07 Identities = 25/59 (42%), Positives = 36/59 (61%) Frame = -2 Query: 178 NVRTYTVMINGLCKEGLFDEALALLSKMEDNGCIPNVVTYEIIILALFEKGENEKAEKL 2 N+R+Y +M+NGLCK L DEA +LL +M+ +PN +TY +I L + A KL Sbjct: 341 NIRSYNIMVNGLCKIKLVDEAASLLEEMQRKNLVPNTITYNTLIDGLCKSKRISCASKL 399 >XP_015966945.1 PREDICTED: pentatricopeptide repeat-containing protein At1g62930, chloroplastic-like isoform X1 [Arachis duranensis] Length = 555 Score = 113 bits (282), Expect = 8e-28 Identities = 51/65 (78%), Positives = 59/65 (90%) Frame = -2 Query: 196 IKGYHLNVRTYTVMINGLCKEGLFDEALALLSKMEDNGCIPNVVTYEIIILALFEKGENE 17 IK YH NVRTYT+MING+C EGLF+EALAL+SKMEDNGC+PN VT+EI+I ALFEKGEN+ Sbjct: 479 IKNYHKNVRTYTIMINGICNEGLFEEALALMSKMEDNGCLPNAVTFEIVIRALFEKGEND 538 Query: 16 KAEKL 2 AEKL Sbjct: 539 MAEKL 543 Score = 54.3 bits (129), Expect = 6e-07 Identities = 25/59 (42%), Positives = 36/59 (61%) Frame = -2 Query: 178 NVRTYTVMINGLCKEGLFDEALALLSKMEDNGCIPNVVTYEIIILALFEKGENEKAEKL 2 N+R+Y +M+NGLCK L DEA +LL +M+ +PN +TY +I L + A KL Sbjct: 345 NIRSYNIMVNGLCKIKLVDEAASLLEEMQRKNLVPNTITYNTLIDGLCKSKRISCASKL 403 >XP_015966877.1 PREDICTED: pentatricopeptide repeat-containing protein At1g12300, mitochondrial-like [Arachis duranensis] Length = 550 Score = 112 bits (280), Expect = 2e-27 Identities = 53/65 (81%), Positives = 57/65 (87%) Frame = -2 Query: 196 IKGYHLNVRTYTVMINGLCKEGLFDEALALLSKMEDNGCIPNVVTYEIIILALFEKGENE 17 IKGYH +VRTYT+MINGLCKEGL EAL LSKMEDNGC+PN VTYEIII ALFEKGEN+ Sbjct: 474 IKGYHPDVRTYTIMINGLCKEGLLHEALVFLSKMEDNGCLPNAVTYEIIIRALFEKGEND 533 Query: 16 KAEKL 2 AEKL Sbjct: 534 NAEKL 538 >XP_016177672.1 PREDICTED: pentatricopeptide repeat-containing protein At1g63130, mitochondrial-like [Arachis ipaensis] XP_016177730.1 PREDICTED: pentatricopeptide repeat-containing protein At1g63130, mitochondrial-like [Arachis ipaensis] Length = 552 Score = 112 bits (279), Expect = 2e-27 Identities = 51/65 (78%), Positives = 59/65 (90%) Frame = -2 Query: 196 IKGYHLNVRTYTVMINGLCKEGLFDEALALLSKMEDNGCIPNVVTYEIIILALFEKGENE 17 IK YH NVRTYT+MI+GLCKEGLF+EALAL+SKMEDNGC+PN VT+EI+I A FEKGEN+ Sbjct: 476 IKNYHPNVRTYTIMISGLCKEGLFEEALALMSKMEDNGCLPNAVTFEIVIRAFFEKGEND 535 Query: 16 KAEKL 2 AEKL Sbjct: 536 MAEKL 540 >KRH39060.1 hypothetical protein GLYMA_09G175400 [Glycine max] Length = 207 Score = 106 bits (265), Expect = 2e-27 Identities = 49/66 (74%), Positives = 57/66 (86%) Frame = -2 Query: 199 LIKGYHLNVRTYTVMINGLCKEGLFDEALALLSKMEDNGCIPNVVTYEIIILALFEKGEN 20 L+KGY +NV TYT+MINGLC +GL DEALA+LSKMED GCIPN VT+EI+I ALFEK N Sbjct: 132 LVKGYRINVYTYTIMINGLCNQGLLDEALAMLSKMEDKGCIPNAVTFEILICALFEKDGN 191 Query: 19 EKAEKL 2 +KAEKL Sbjct: 192 DKAEKL 197 >XP_016203409.1 PREDICTED: pentatricopeptide repeat-containing protein At1g63080, mitochondrial-like [Arachis ipaensis] Length = 348 Score = 109 bits (273), Expect = 2e-27 Identities = 52/65 (80%), Positives = 57/65 (87%) Frame = -2 Query: 196 IKGYHLNVRTYTVMINGLCKEGLFDEALALLSKMEDNGCIPNVVTYEIIILALFEKGENE 17 IKGY ++RTYT+MINGLCKEGL EALA LSKMEDNGC+PN VTYEIII ALFEKGEN+ Sbjct: 272 IKGYRPDMRTYTIMINGLCKEGLLHEALAFLSKMEDNGCLPNAVTYEIIIRALFEKGEND 331 Query: 16 KAEKL 2 AEKL Sbjct: 332 NAEKL 336 >XP_016203501.1 PREDICTED: pentatricopeptide repeat-containing protein At1g62930, chloroplastic-like [Arachis ipaensis] XP_016203502.1 PREDICTED: pentatricopeptide repeat-containing protein At1g62930, chloroplastic-like [Arachis ipaensis] Length = 554 Score = 111 bits (278), Expect = 3e-27 Identities = 52/65 (80%), Positives = 58/65 (89%) Frame = -2 Query: 196 IKGYHLNVRTYTVMINGLCKEGLFDEALALLSKMEDNGCIPNVVTYEIIILALFEKGENE 17 IKGYH +VRTYT+MINGLCKEGL EALA LSKMEDNGC+PN +TYEIII ALFE+GEN+ Sbjct: 478 IKGYHPDVRTYTIMINGLCKEGLLHEALAFLSKMEDNGCLPNAMTYEIIIRALFERGEND 537 Query: 16 KAEKL 2 AEKL Sbjct: 538 NAEKL 542 Score = 52.4 bits (124), Expect = 3e-06 Identities = 22/44 (50%), Positives = 29/44 (65%) Frame = -2 Query: 178 NVRTYTVMINGLCKEGLFDEALALLSKMEDNGCIPNVVTYEIII 47 NVR+Y +MING CK + D+AL L +M +PN VTY I+I Sbjct: 344 NVRSYNIMINGFCKSKMIDDALNLFEEMHRKNLVPNTVTYSILI 387 >XP_013452887.1 pentatricopeptide (PPR) repeat protein [Medicago truncatula] KEH26915.1 pentatricopeptide (PPR) repeat protein [Medicago truncatula] Length = 103 Score = 102 bits (255), Expect = 4e-27 Identities = 49/66 (74%), Positives = 57/66 (86%) Frame = -2 Query: 199 LIKGYHLNVRTYTVMINGLCKEGLFDEALALLSKMEDNGCIPNVVTYEIIILALFEKGEN 20 L+KGY+L+V YTVMI G C +GLFDEALALLSKME+NGCIP+ TYEIIIL+LFEK EN Sbjct: 28 LVKGYNLDVYAYTVMIQGFCDKGLFDEALALLSKMEENGCIPDAKTYEIIILSLFEKDEN 87 Query: 19 EKAEKL 2 + AEKL Sbjct: 88 DMAEKL 93 >XP_016203414.1 PREDICTED: pentatricopeptide repeat-containing protein At1g62930, chloroplastic-like [Arachis ipaensis] Length = 324 Score = 108 bits (270), Expect = 4e-27 Identities = 51/65 (78%), Positives = 57/65 (87%) Frame = -2 Query: 196 IKGYHLNVRTYTVMINGLCKEGLFDEALALLSKMEDNGCIPNVVTYEIIILALFEKGENE 17 IKGY ++RTYT+MINGLCKEGL EALA LSKMEDNGC+PN VTYEIII ALFE+GEN+ Sbjct: 248 IKGYRPDMRTYTIMINGLCKEGLLHEALAFLSKMEDNGCLPNAVTYEIIIRALFERGEND 307 Query: 16 KAEKL 2 AEKL Sbjct: 308 NAEKL 312 Score = 51.2 bits (121), Expect = 7e-06 Identities = 29/66 (43%), Positives = 41/66 (62%) Frame = -2 Query: 199 LIKGYHLNVRTYTVMINGLCKEGLFDEALALLSKMEDNGCIPNVVTYEIIILALFEKGEN 20 L KG NV TY+ +I GLC G + EA+ LLS+M IPNV TY I+I L ++G+ Sbjct: 2 LAKGISPNVITYSSLIFGLCLVGQYKEAIDLLSEMVLRNIIPNVRTYSILIDGLCKEGKI 61 Query: 19 EKAEKL 2 + A+ + Sbjct: 62 KDAKNV 67 >KHN32591.1 Putative pentatricopeptide repeat-containing protein, mitochondrial [Glycine soja] Length = 425 Score = 110 bits (274), Expect = 4e-27 Identities = 52/66 (78%), Positives = 60/66 (90%) Frame = -2 Query: 199 LIKGYHLNVRTYTVMINGLCKEGLFDEALALLSKMEDNGCIPNVVTYEIIILALFEKGEN 20 L+KGY +NV TYTVMI+GLCKEG+FDEALA+ SKMEDNGCIPN VT+EIII +LFEK EN Sbjct: 342 LVKGYCINVWTYTVMISGLCKEGMFDEALAMKSKMEDNGCIPNAVTFEIIIRSLFEKDEN 401 Query: 19 EKAEKL 2 +KAEKL Sbjct: 402 DKAEKL 407 Score = 51.2 bits (121), Expect = 7e-06 Identities = 26/64 (40%), Positives = 39/64 (60%) Frame = -2 Query: 193 KGYHLNVRTYTVMINGLCKEGLFDEALALLSKMEDNGCIPNVVTYEIIILALFEKGENEK 14 +G +V TYT +++GLCK FD+A AL KM++ G PN TY +I L + G + Sbjct: 274 RGQQADVVTYTSLLDGLCKNENFDKATALFMKMKEWGIQPNKYTYTALIDGLCKSGRLKN 333 Query: 13 AEKL 2 A++L Sbjct: 334 AQEL 337 >XP_016165834.1 PREDICTED: pentatricopeptide repeat-containing protein At1g12620-like [Arachis ipaensis] XP_016165835.1 PREDICTED: pentatricopeptide repeat-containing protein At1g12620-like [Arachis ipaensis] Length = 550 Score = 110 bits (275), Expect = 8e-27 Identities = 53/65 (81%), Positives = 58/65 (89%) Frame = -2 Query: 196 IKGYHLNVRTYTVMINGLCKEGLFDEALALLSKMEDNGCIPNVVTYEIIILALFEKGENE 17 IKGY +V+TYT+MINGLCKEGL EALALLSKMEDNGC+PN VTYEIII ALFEKGEN+ Sbjct: 474 IKGYRPDVKTYTIMINGLCKEGLLHEALALLSKMEDNGCLPNAVTYEIIIGALFEKGEND 533 Query: 16 KAEKL 2 AEKL Sbjct: 534 NAEKL 538 >XP_015966952.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial [Arachis duranensis] XP_015966953.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial [Arachis duranensis] Length = 564 Score = 110 bits (275), Expect = 8e-27 Identities = 51/65 (78%), Positives = 59/65 (90%) Frame = -2 Query: 196 IKGYHLNVRTYTVMINGLCKEGLFDEALALLSKMEDNGCIPNVVTYEIIILALFEKGENE 17 IK Y NVRTYT+MINGLCKEGLF+EALAL+SKMEDNGC+P+ VT+EI+I ALFEKGEN+ Sbjct: 488 IKSYRPNVRTYTIMINGLCKEGLFEEALALMSKMEDNGCLPDAVTFEIVIRALFEKGEND 547 Query: 16 KAEKL 2 AEKL Sbjct: 548 MAEKL 552