BLASTX nr result
ID: Glycyrrhiza29_contig00037708
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza29_contig00037708 (258 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AAB40028.1 S6-RNase [Nicotiana alata] 58 3e-08 Q40379.2 RecName: Full=Ribonuclease S-6; AltName: Full=S6-RNase;... 58 3e-08 XP_012572810.1 PREDICTED: ribonuclease 1-like [Cicer arietinum] 58 4e-08 Q40381.1 RecName: Full=Ribonuclease S-7; AltName: Full=S7-RNase;... 56 1e-07 pir||S28611 ribonuclease X2 (EC 3.1.-.-) precursor - Petunia inf... 56 2e-07 XP_004505385.1 PREDICTED: ribonuclease MC-like [Cicer arietinum] 56 2e-07 BAA24017.1 ribonuclease [Nicotiana alata] 56 2e-07 Q01796.1 RecName: Full=Ribonuclease S-2; AltName: Full=S2-RNase;... 55 3e-07 XP_004517056.1 PREDICTED: ribonuclease S-1-like [Cicer arietinum] 53 8e-07 BAA24018.1 ribonuclease precursor [Nicotiana alata] 54 1e-06 CAA40216.1 S2-protein, partial [Solanum chacoense] 53 2e-06 KRH67902.1 hypothetical protein GLYMA_03G194500 [Glycine max] 53 3e-06 KHN18763.1 Intracellular ribonuclease LX [Glycine soja] 53 4e-06 >AAB40028.1 S6-RNase [Nicotiana alata] Length = 215 Score = 58.2 bits (139), Expect = 3e-08 Identities = 22/52 (42%), Positives = 32/52 (61%) Frame = -1 Query: 171 ILLLFFVTVAPCFSAYDYMMFSLQWPRIVCIFNGPCTTSPYNFTIHGMWPNN 16 + ++F ++P + A++YM LQWP C PC P NFTIHG+WP+N Sbjct: 9 VFVIFLFALSPIYGAFEYMQLVLQWPTTFC-HTTPCKNIPSNFTIHGLWPDN 59 >Q40379.2 RecName: Full=Ribonuclease S-6; AltName: Full=S6-RNase; AltName: Full=Stylar glycoprotein 6; Flags: Precursor Length = 215 Score = 58.2 bits (139), Expect = 3e-08 Identities = 22/52 (42%), Positives = 32/52 (61%) Frame = -1 Query: 171 ILLLFFVTVAPCFSAYDYMMFSLQWPRIVCIFNGPCTTSPYNFTIHGMWPNN 16 + ++F ++P + A++YM LQWP C PC P NFTIHG+WP+N Sbjct: 9 VFVIFLFALSPIYGAFEYMQLVLQWPTAFC-HTTPCKNIPSNFTIHGLWPDN 59 >XP_012572810.1 PREDICTED: ribonuclease 1-like [Cicer arietinum] Length = 214 Score = 57.8 bits (138), Expect = 4e-08 Identities = 25/62 (40%), Positives = 37/62 (59%), Gaps = 6/62 (9%) Frame = -1 Query: 168 LLLFFVTVAPCFSAYDYMMFSLQWPRIVC-----IFNGPCTTS-PYNFTIHGMWPNNRIG 7 L+LF + ++ +SAYDY M + QWP C N PC + P FT+HG+WP+N G Sbjct: 4 LMLFVLLLSTSYSAYDYYMLAQQWPTTYCRHSPQTINNPCNPNVPIKFTLHGLWPSNHSG 63 Query: 6 NK 1 ++ Sbjct: 64 SR 65 >Q40381.1 RecName: Full=Ribonuclease S-7; AltName: Full=S7-RNase; AltName: Full=Stylar glycoprotein 7; Flags: Precursor AAA87898.1 S7-RNase [Nicotiana alata] Length = 218 Score = 56.2 bits (134), Expect = 1e-07 Identities = 22/52 (42%), Positives = 31/52 (59%) Frame = -1 Query: 171 ILLLFFVTVAPCFSAYDYMMFSLQWPRIVCIFNGPCTTSPYNFTIHGMWPNN 16 +L + ++P + A++YM LQWP C PC P NFTIHG+WP+N Sbjct: 9 VLFVLLFVLSPIYGAFEYMQLVLQWPTAFC-HTTPCKRIPNNFTIHGLWPDN 59 >pir||S28611 ribonuclease X2 (EC 3.1.-.-) precursor - Petunia inflata Length = 215 Score = 55.8 bits (133), Expect = 2e-07 Identities = 22/53 (41%), Positives = 33/53 (62%), Gaps = 1/53 (1%) Frame = -1 Query: 171 ILLLFFVTVAPCFSAY-DYMMFSLQWPRIVCIFNGPCTTSPYNFTIHGMWPNN 16 +L + +++P + AY +YM LQWP C + C +P NFTIHG+WP+N Sbjct: 9 VLFILLFSLSPIYGAYYEYMQLVLQWPTAFCHASPTCKVTPNNFTIHGLWPDN 61 >XP_004505385.1 PREDICTED: ribonuclease MC-like [Cicer arietinum] Length = 218 Score = 55.8 bits (133), Expect = 2e-07 Identities = 24/60 (40%), Positives = 35/60 (58%), Gaps = 1/60 (1%) Frame = -1 Query: 189 MAAIAYILLLFFVTVAPCFSAYDYMMFSLQWPRIVCIFNGPCTTSPYN-FTIHGMWPNNR 13 M + IL ++F + PC ++Y + + QWP C N PC T P FTIHG+WP+N+ Sbjct: 7 MKVLVMILFIYFTFLLPCLASYQFFKMAEQWPPTFCRSN-PCPTIPQGKFTIHGLWPSNQ 65 >BAA24017.1 ribonuclease [Nicotiana alata] Length = 219 Score = 55.8 bits (133), Expect = 2e-07 Identities = 21/58 (36%), Positives = 35/58 (60%) Frame = -1 Query: 180 IAYILLLFFVTVAPCFSAYDYMMFSLQWPRIVCIFNGPCTTSPYNFTIHGMWPNNRIG 7 + ++L + F++++P + +D + L WP C PCT P NFTIHG+WP+ + G Sbjct: 6 LMFVLFILFLSLSPVYGTFDQLQLVLTWPPSFC-HGKPCTRIPKNFTIHGLWPDEQHG 62 >Q01796.1 RecName: Full=Ribonuclease S-2; AltName: Full=S2-RNase; AltName: Full=Stylar glycoprotein 2; Flags: Precursor CAA44600.1 S2 RNase [Solanum tuberosum] Length = 223 Score = 55.5 bits (132), Expect = 3e-07 Identities = 23/53 (43%), Positives = 32/53 (60%), Gaps = 1/53 (1%) Frame = -1 Query: 168 LLLFFVTVAPCFSAYDYMMFSLQWPRIVCIFNGPCT-TSPYNFTIHGMWPNNR 13 L +FF +++P + +DYM L WPR C G C P NFTIHG+WP+ + Sbjct: 10 LFVFFFSLSPIYGDFDYMQLVLTWPRSFCYPRGFCNRIPPNNFTIHGLWPDKK 62 >XP_004517056.1 PREDICTED: ribonuclease S-1-like [Cicer arietinum] Length = 125 Score = 52.8 bits (125), Expect = 8e-07 Identities = 23/61 (37%), Positives = 35/61 (57%), Gaps = 6/61 (9%) Frame = -1 Query: 168 LLLFFVTVAPCFSAYDYMMFSLQWPRIVC-----IFNGPCTTS-PYNFTIHGMWPNNRIG 7 L++F + ++ +SAYDY + QWP C N PC + P FT+HG+WP+N G Sbjct: 4 LMVFVLLLSTSYSAYDYYKLAQQWPTTYCRHSPQTINKPCNPNVPIKFTLHGLWPSNHSG 63 Query: 6 N 4 + Sbjct: 64 S 64 >BAA24018.1 ribonuclease precursor [Nicotiana alata] Length = 218 Score = 53.5 bits (127), Expect = 1e-06 Identities = 23/53 (43%), Positives = 32/53 (60%) Frame = -1 Query: 174 YILLLFFVTVAPCFSAYDYMMFSLQWPRIVCIFNGPCTTSPYNFTIHGMWPNN 16 + +LLF ++P + ++YM LQWP C CT P NFTIHG+WP+N Sbjct: 10 FFILLF--ALSPIYGTFEYMQLVLQWPTAFC-HTTACTIIPTNFTIHGLWPDN 59 >CAA40216.1 S2-protein, partial [Solanum chacoense] Length = 211 Score = 53.1 bits (126), Expect = 2e-06 Identities = 21/50 (42%), Positives = 31/50 (62%) Frame = -1 Query: 162 LFFVTVAPCFSAYDYMMFSLQWPRIVCIFNGPCTTSPYNFTIHGMWPNNR 13 + F ++P + +DYM LQWP + C N C P NFT+HG+WP+N+ Sbjct: 4 VLFFCLSPVYGTFDYMKLVLQWPPMYCR-NKFCERIPRNFTVHGLWPDNK 52 >KRH67902.1 hypothetical protein GLYMA_03G194500 [Glycine max] Length = 231 Score = 52.8 bits (125), Expect = 3e-06 Identities = 24/61 (39%), Positives = 30/61 (49%), Gaps = 3/61 (4%) Frame = -1 Query: 180 IAYILLLFFVTVAPCFSAYDYMMFSLQWPRIVCIFNG---PCTTSPYNFTIHGMWPNNRI 10 I L+ + V F++YD+ M S WP C PC P FTIHG+WP N I Sbjct: 11 ICVFSLVLVLNVPISFASYDFFMLSETWPATYCGIKNRLLPCAKQPNTFTIHGLWPQNHI 70 Query: 9 G 7 G Sbjct: 71 G 71 >KHN18763.1 Intracellular ribonuclease LX [Glycine soja] Length = 257 Score = 52.8 bits (125), Expect = 4e-06 Identities = 24/61 (39%), Positives = 30/61 (49%), Gaps = 3/61 (4%) Frame = -1 Query: 180 IAYILLLFFVTVAPCFSAYDYMMFSLQWPRIVCIFNG---PCTTSPYNFTIHGMWPNNRI 10 I L+ + V F++YD+ M S WP C PC P FTIHG+WP N I Sbjct: 37 ICVFSLVLVLNVPISFASYDFFMLSETWPATYCGIKNRLLPCAKQPNTFTIHGLWPQNHI 96 Query: 9 G 7 G Sbjct: 97 G 97