BLASTX nr result
ID: Glycyrrhiza29_contig00037679
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza29_contig00037679 (225 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_004515902.1 PREDICTED: pentatricopeptide repeat-containing pr... 121 2e-30 GAU10023.1 hypothetical protein TSUD_412650 [Trifolium subterran... 119 2e-30 XP_019464696.1 PREDICTED: pentatricopeptide repeat-containing pr... 120 5e-30 XP_007155484.1 hypothetical protein PHAVU_003G205300g [Phaseolus... 117 3e-29 KYP70216.1 hypothetical protein KK1_009427 [Cajanus cajan] 116 8e-29 KHN18411.1 Pentatricopeptide repeat-containing protein, chloropl... 115 1e-28 XP_014490566.1 PREDICTED: pentatricopeptide repeat-containing pr... 114 2e-28 XP_003550712.1 PREDICTED: pentatricopeptide repeat-containing pr... 115 2e-28 KOM32754.1 hypothetical protein LR48_Vigan01g231000 [Vigna angul... 115 2e-28 XP_017420755.1 PREDICTED: pentatricopeptide repeat-containing pr... 115 2e-28 XP_013457737.1 PPR containing plant protein [Medicago truncatula... 114 6e-28 XP_017418974.1 PREDICTED: pentatricopeptide repeat-containing pr... 114 6e-28 XP_014490582.1 PREDICTED: pentatricopeptide repeat-containing pr... 112 2e-27 XP_007155485.1 hypothetical protein PHAVU_003G205400g [Phaseolus... 112 3e-27 XP_015970183.1 PREDICTED: pentatricopeptide repeat-containing pr... 111 7e-27 XP_018840083.1 PREDICTED: pentatricopeptide repeat-containing pr... 110 9e-27 XP_016176077.1 PREDICTED: pentatricopeptide repeat-containing pr... 110 1e-26 XP_015939849.1 PREDICTED: pentatricopeptide repeat-containing pr... 110 1e-26 XP_016190144.1 PREDICTED: pentatricopeptide repeat-containing pr... 110 1e-26 XP_018809541.1 PREDICTED: pentatricopeptide repeat-containing pr... 107 4e-26 >XP_004515902.1 PREDICTED: pentatricopeptide repeat-containing protein At3g48250, chloroplastic-like [Cicer arietinum] Length = 635 Score = 121 bits (303), Expect = 2e-30 Identities = 58/74 (78%), Positives = 63/74 (85%) Frame = +2 Query: 2 ENIVKTMRSAGYEPDNITYSHVVSGLCKMKRFEEAWKVLEEMESCGCIPDSNTRSILIHG 181 E IVKTM +AG+EPD++TYS VV GLCKMKR EEA KVLE+ME CGCIPDSNT SILI G Sbjct: 394 EKIVKTMSNAGFEPDSVTYSQVVFGLCKMKRLEEAHKVLEDMECCGCIPDSNTWSILIQG 453 Query: 182 YCAANEVDNALLCL 223 YCAANEVD AL CL Sbjct: 454 YCAANEVDKALHCL 467 >GAU10023.1 hypothetical protein TSUD_412650 [Trifolium subterraneum] GAU10021.1 hypothetical protein TSUD_412630 [Trifolium subterraneum] Length = 455 Score = 119 bits (299), Expect = 2e-30 Identities = 58/74 (78%), Positives = 64/74 (86%) Frame = +2 Query: 2 ENIVKTMRSAGYEPDNITYSHVVSGLCKMKRFEEAWKVLEEMESCGCIPDSNTRSILIHG 181 ENIVKTMR+AGYEPDN TY+ VV GLCKMKR EEA KVLEEMES GCIPD+ T SILI G Sbjct: 215 ENIVKTMRNAGYEPDNTTYNQVVFGLCKMKRVEEACKVLEEMESSGCIPDNKTWSILIQG 274 Query: 182 YCAANEVDNALLCL 223 +CAA+E+D ALLCL Sbjct: 275 HCAADELDKALLCL 288 >XP_019464696.1 PREDICTED: pentatricopeptide repeat-containing protein At3g48250, chloroplastic [Lupinus angustifolius] OIW00303.1 hypothetical protein TanjilG_27554 [Lupinus angustifolius] Length = 620 Score = 120 bits (300), Expect = 5e-30 Identities = 58/73 (79%), Positives = 63/73 (86%) Frame = +2 Query: 2 ENIVKTMRSAGYEPDNITYSHVVSGLCKMKRFEEAWKVLEEMESCGCIPDSNTRSILIHG 181 ENIV+TMR+AG+EPDNITYS VV GLCKMKRFEEA KVLEEMES GCIPD T +ILI G Sbjct: 392 ENIVQTMRNAGFEPDNITYSQVVFGLCKMKRFEEACKVLEEMESSGCIPDIKTWTILIQG 451 Query: 182 YCAANEVDNALLC 220 +CA NEVD ALLC Sbjct: 452 HCAGNEVDKALLC 464 >XP_007155484.1 hypothetical protein PHAVU_003G205300g [Phaseolus vulgaris] ESW27478.1 hypothetical protein PHAVU_003G205300g [Phaseolus vulgaris] Length = 631 Score = 117 bits (294), Expect = 3e-29 Identities = 55/73 (75%), Positives = 64/73 (87%) Frame = +2 Query: 2 ENIVKTMRSAGYEPDNITYSHVVSGLCKMKRFEEAWKVLEEMESCGCIPDSNTRSILIHG 181 ENIV+TMR+AG++PDNITYS VV GLCKM+RFEEA KVLEEMESCGCIPD T +ILI G Sbjct: 389 ENIVRTMRNAGHKPDNITYSQVVYGLCKMRRFEEACKVLEEMESCGCIPDIKTWTILIQG 448 Query: 182 YCAANEVDNALLC 220 +C ANE++ ALLC Sbjct: 449 HCDANELEKALLC 461 >KYP70216.1 hypothetical protein KK1_009427 [Cajanus cajan] Length = 624 Score = 116 bits (291), Expect = 8e-29 Identities = 55/73 (75%), Positives = 63/73 (86%) Frame = +2 Query: 2 ENIVKTMRSAGYEPDNITYSHVVSGLCKMKRFEEAWKVLEEMESCGCIPDSNTRSILIHG 181 ENIV+TMR+AG+EPDNITYS +V GLCKM+RFEEA+KVLEEMESCGCIPD T +ILI G Sbjct: 384 ENIVRTMRNAGHEPDNITYSQLVFGLCKMRRFEEAYKVLEEMESCGCIPDIKTWTILIQG 443 Query: 182 YCAANEVDNALLC 220 + NEVD ALLC Sbjct: 444 HYDGNEVDKALLC 456 >KHN18411.1 Pentatricopeptide repeat-containing protein, chloroplastic [Glycine soja] Length = 545 Score = 115 bits (289), Expect = 1e-28 Identities = 55/73 (75%), Positives = 63/73 (86%) Frame = +2 Query: 2 ENIVKTMRSAGYEPDNITYSHVVSGLCKMKRFEEAWKVLEEMESCGCIPDSNTRSILIHG 181 ENIV+TMR+AGYEPDNITYS +V GLCKM+RFEEA KVLE+MES CIPD T +ILI G Sbjct: 301 ENIVRTMRNAGYEPDNITYSQMVFGLCKMRRFEEACKVLEDMESSRCIPDIKTWTILIQG 360 Query: 182 YCAANEVDNALLC 220 +C+ANEVD ALLC Sbjct: 361 HCSANEVDKALLC 373 >XP_014490566.1 PREDICTED: pentatricopeptide repeat-containing protein At3g48250, chloroplastic-like [Vigna radiata var. radiata] Length = 451 Score = 114 bits (286), Expect = 2e-28 Identities = 51/74 (68%), Positives = 61/74 (82%) Frame = +2 Query: 2 ENIVKTMRSAGYEPDNITYSHVVSGLCKMKRFEEAWKVLEEMESCGCIPDSNTRSILIHG 181 E+IV MR AG+EPDNITY V+ G CKM+R EEA KV+EEMESCGCIPD+NT ++L+ G Sbjct: 215 EDIVNLMRKAGHEPDNITYGQVIVGFCKMRRLEEACKVMEEMESCGCIPDTNTWTLLVQG 274 Query: 182 YCAANEVDNALLCL 223 +C ANEVD ALLCL Sbjct: 275 HCVANEVDRALLCL 288 >XP_003550712.1 PREDICTED: pentatricopeptide repeat-containing protein At3g48250, chloroplastic [Glycine max] KRH03217.1 hypothetical protein GLYMA_17G084400 [Glycine max] Length = 635 Score = 115 bits (289), Expect = 2e-28 Identities = 55/73 (75%), Positives = 63/73 (86%) Frame = +2 Query: 2 ENIVKTMRSAGYEPDNITYSHVVSGLCKMKRFEEAWKVLEEMESCGCIPDSNTRSILIHG 181 ENIV+TMR+AGYEPDNITYS +V GLCKM+RFEEA KVLE+MES CIPD T +ILI G Sbjct: 391 ENIVRTMRNAGYEPDNITYSQMVFGLCKMRRFEEACKVLEDMESSRCIPDIKTWTILIQG 450 Query: 182 YCAANEVDNALLC 220 +C+ANEVD ALLC Sbjct: 451 HCSANEVDKALLC 463 >KOM32754.1 hypothetical protein LR48_Vigan01g231000 [Vigna angularis] Length = 599 Score = 115 bits (288), Expect = 2e-28 Identities = 54/73 (73%), Positives = 63/73 (86%) Frame = +2 Query: 2 ENIVKTMRSAGYEPDNITYSHVVSGLCKMKRFEEAWKVLEEMESCGCIPDSNTRSILIHG 181 ENIV+TMR+AG+EPDNITYS +V GLCKM+RFEEA KVLEEM+SCGCIPD T +ILI G Sbjct: 388 ENIVRTMRNAGHEPDNITYSQLVFGLCKMRRFEEACKVLEEMQSCGCIPDIKTWTILIQG 447 Query: 182 YCAANEVDNALLC 220 +C A E+D ALLC Sbjct: 448 HCDAMELDKALLC 460 >XP_017420755.1 PREDICTED: pentatricopeptide repeat-containing protein At3g48250, chloroplastic-like isoform X1 [Vigna angularis] XP_017420836.1 PREDICTED: pentatricopeptide repeat-containing protein At3g48250, chloroplastic-like isoform X2 [Vigna angularis] BAT76029.1 hypothetical protein VIGAN_01398200 [Vigna angularis var. angularis] Length = 630 Score = 115 bits (288), Expect = 2e-28 Identities = 54/73 (73%), Positives = 63/73 (86%) Frame = +2 Query: 2 ENIVKTMRSAGYEPDNITYSHVVSGLCKMKRFEEAWKVLEEMESCGCIPDSNTRSILIHG 181 ENIV+TMR+AG+EPDNITYS +V GLCKM+RFEEA KVLEEM+SCGCIPD T +ILI G Sbjct: 388 ENIVRTMRNAGHEPDNITYSQLVFGLCKMRRFEEACKVLEEMQSCGCIPDIKTWTILIQG 447 Query: 182 YCAANEVDNALLC 220 +C A E+D ALLC Sbjct: 448 HCDAMELDKALLC 460 >XP_013457737.1 PPR containing plant protein [Medicago truncatula] KEH31768.1 PPR containing plant protein [Medicago truncatula] Length = 628 Score = 114 bits (285), Expect = 6e-28 Identities = 55/74 (74%), Positives = 61/74 (82%) Frame = +2 Query: 2 ENIVKTMRSAGYEPDNITYSHVVSGLCKMKRFEEAWKVLEEMESCGCIPDSNTRSILIHG 181 ENIVKTMR+ G+EPDN TYS +V GLCKMKR EEA KVLEEMES GCIPD+ T SI I G Sbjct: 390 ENIVKTMRNGGHEPDNTTYSQLVFGLCKMKRVEEACKVLEEMESSGCIPDNKTWSIFIQG 449 Query: 182 YCAANEVDNALLCL 223 +CAAN +D ALLCL Sbjct: 450 HCAANALDKALLCL 463 >XP_017418974.1 PREDICTED: pentatricopeptide repeat-containing protein At3g48250, chloroplastic-like [Vigna angularis] KOM32753.1 hypothetical protein LR48_Vigan01g230900 [Vigna angularis] BAT76028.1 hypothetical protein VIGAN_01398100 [Vigna angularis var. angularis] Length = 631 Score = 114 bits (285), Expect = 6e-28 Identities = 51/74 (68%), Positives = 60/74 (81%) Frame = +2 Query: 2 ENIVKTMRSAGYEPDNITYSHVVSGLCKMKRFEEAWKVLEEMESCGCIPDSNTRSILIHG 181 ENIV MR AG+EPDNITY V+ G CKM+R EEA KV+EEMESCGCIPD+ T ++L+ G Sbjct: 395 ENIVNRMRKAGHEPDNITYGQVIVGFCKMRRLEEACKVMEEMESCGCIPDTKTWTLLVQG 454 Query: 182 YCAANEVDNALLCL 223 +C ANEVD ALLCL Sbjct: 455 HCVANEVDRALLCL 468 >XP_014490582.1 PREDICTED: pentatricopeptide repeat-containing protein At3g48250, chloroplastic-like [Vigna radiata var. radiata] Length = 630 Score = 112 bits (281), Expect = 2e-27 Identities = 52/73 (71%), Positives = 63/73 (86%) Frame = +2 Query: 2 ENIVKTMRSAGYEPDNITYSHVVSGLCKMKRFEEAWKVLEEMESCGCIPDSNTRSILIHG 181 E+IV+TMR+AG+EPDNIT+S +V GLCKM+RFEEA KVLEEM+SCGCIPD T +ILI G Sbjct: 388 ESIVRTMRNAGHEPDNITFSQLVFGLCKMRRFEEACKVLEEMQSCGCIPDIKTWTILIQG 447 Query: 182 YCAANEVDNALLC 220 +C A E+D ALLC Sbjct: 448 HCDAKELDKALLC 460 >XP_007155485.1 hypothetical protein PHAVU_003G205400g [Phaseolus vulgaris] ESW27479.1 hypothetical protein PHAVU_003G205400g [Phaseolus vulgaris] Length = 636 Score = 112 bits (280), Expect = 3e-27 Identities = 50/74 (67%), Positives = 61/74 (82%) Frame = +2 Query: 2 ENIVKTMRSAGYEPDNITYSHVVSGLCKMKRFEEAWKVLEEMESCGCIPDSNTRSILIHG 181 E+IV MR+AG+EPDNITY V+ G CKM+R EEA KVLE+MESCGCIPD+ T ++L+ G Sbjct: 395 EDIVNRMRNAGHEPDNITYGQVIVGFCKMRRLEEACKVLEDMESCGCIPDTKTWTLLVQG 454 Query: 182 YCAANEVDNALLCL 223 YC A+EVD ALLCL Sbjct: 455 YCVASEVDKALLCL 468 >XP_015970183.1 PREDICTED: pentatricopeptide repeat-containing protein At3g48250, chloroplastic-like [Arachis duranensis] XP_015970188.1 PREDICTED: pentatricopeptide repeat-containing protein At3g48250, chloroplastic-like [Arachis duranensis] Length = 643 Score = 111 bits (277), Expect = 7e-27 Identities = 51/73 (69%), Positives = 61/73 (83%) Frame = +2 Query: 2 ENIVKTMRSAGYEPDNITYSHVVSGLCKMKRFEEAWKVLEEMESCGCIPDSNTRSILIHG 181 E IV +MR++GYEPDN+T+S +V GLCKM R EEA KVLEEMESCGCIPD T +ILI G Sbjct: 402 ETIVGSMRNSGYEPDNVTFSQMVFGLCKMGRLEEACKVLEEMESCGCIPDIKTWTILIRG 461 Query: 182 YCAANEVDNALLC 220 +C+ANE+D ALLC Sbjct: 462 HCSANEIDKALLC 474 >XP_018840083.1 PREDICTED: pentatricopeptide repeat-containing protein At3g48250, chloroplastic [Juglans regia] Length = 626 Score = 110 bits (276), Expect = 9e-27 Identities = 51/74 (68%), Positives = 62/74 (83%) Frame = +2 Query: 2 ENIVKTMRSAGYEPDNITYSHVVSGLCKMKRFEEAWKVLEEMESCGCIPDSNTRSILIHG 181 ENI+K MR+AGY+PDNITYS VV GLCKM+R EEA KVL+EME GC+PD T +ILI G Sbjct: 389 ENIMKVMRNAGYQPDNITYSQVVFGLCKMRRLEEACKVLDEMEEQGCLPDIKTWTILIQG 448 Query: 182 YCAANEVDNALLCL 223 +CAANE++ AL+CL Sbjct: 449 HCAANELEKALMCL 462 >XP_016176077.1 PREDICTED: pentatricopeptide repeat-containing protein At3g48250, chloroplastic [Arachis ipaensis] Length = 643 Score = 110 bits (276), Expect = 1e-26 Identities = 53/73 (72%), Positives = 59/73 (80%) Frame = +2 Query: 2 ENIVKTMRSAGYEPDNITYSHVVSGLCKMKRFEEAWKVLEEMESCGCIPDSNTRSILIHG 181 E IV TMR+AGYEPDNITYS +V GLCK +R EEA KVL+EMESCGCIPD T +ILI G Sbjct: 406 EKIVHTMRNAGYEPDNITYSQLVFGLCKTRRLEEACKVLDEMESCGCIPDIKTWTILIKG 465 Query: 182 YCAANEVDNALLC 220 +C A EVD ALLC Sbjct: 466 HCDAKEVDKALLC 478 >XP_015939849.1 PREDICTED: pentatricopeptide repeat-containing protein At3g48250, chloroplastic [Arachis duranensis] XP_015939850.1 PREDICTED: pentatricopeptide repeat-containing protein At3g48250, chloroplastic [Arachis duranensis] Length = 643 Score = 110 bits (276), Expect = 1e-26 Identities = 53/73 (72%), Positives = 59/73 (80%) Frame = +2 Query: 2 ENIVKTMRSAGYEPDNITYSHVVSGLCKMKRFEEAWKVLEEMESCGCIPDSNTRSILIHG 181 E IV TMR+AGYEPDNITYS +V GLCK +R EEA KVL+EMESCGCIPD T +ILI G Sbjct: 406 EKIVHTMRNAGYEPDNITYSQLVFGLCKTRRLEEACKVLDEMESCGCIPDIKTWTILIKG 465 Query: 182 YCAANEVDNALLC 220 +C A EVD ALLC Sbjct: 466 HCDAKEVDKALLC 478 >XP_016190144.1 PREDICTED: pentatricopeptide repeat-containing protein At3g48250, chloroplastic-like [Arachis ipaensis] XP_016190153.1 PREDICTED: pentatricopeptide repeat-containing protein At3g48250, chloroplastic-like [Arachis ipaensis] Length = 643 Score = 110 bits (275), Expect = 1e-26 Identities = 51/73 (69%), Positives = 61/73 (83%) Frame = +2 Query: 2 ENIVKTMRSAGYEPDNITYSHVVSGLCKMKRFEEAWKVLEEMESCGCIPDSNTRSILIHG 181 E IV +MR++GYEPDN+T+S +V GLCKM R EEA KVLEEMESCGCIPD T +ILI G Sbjct: 402 ETIVGSMRNSGYEPDNVTFSQMVFGLCKMGRLEEACKVLEEMESCGCIPDIKTWTILIRG 461 Query: 182 YCAANEVDNALLC 220 +C+ANE+D ALLC Sbjct: 462 HCSANEMDKALLC 474 >XP_018809541.1 PREDICTED: pentatricopeptide repeat-containing protein At3g48250, chloroplastic-like, partial [Juglans regia] Length = 381 Score = 107 bits (267), Expect = 4e-26 Identities = 50/74 (67%), Positives = 60/74 (81%) Frame = +2 Query: 2 ENIVKTMRSAGYEPDNITYSHVVSGLCKMKRFEEAWKVLEEMESCGCIPDSNTRSILIHG 181 EN++K MR+AGY PDNITYS VV GLCK RFE+A KVL+EME+ GC+PD T +ILI G Sbjct: 144 ENVMKVMRNAGYPPDNITYSQVVFGLCKTSRFEKACKVLDEMEAQGCLPDIKTWTILIQG 203 Query: 182 YCAANEVDNALLCL 223 CAANEV+ AL+CL Sbjct: 204 LCAANEVEKALMCL 217