BLASTX nr result
ID: Glycyrrhiza29_contig00037664
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza29_contig00037664 (209 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006599370.1 PREDICTED: auxilin-related protein 2-like [Glycin... 124 1e-35 XP_012573701.1 PREDICTED: auxilin-like protein 1 [Cicer arietinum] 131 6e-34 KHN11110.1 Auxilin-related protein 1 [Glycine soja] 129 9e-34 XP_019056908.1 PREDICTED: auxilin-like protein 1 isoform X1 [Tar... 130 1e-33 XP_019056910.1 PREDICTED: trichohyalin isoform X2 [Tarenaya hass... 130 1e-33 XP_002310250.2 hypothetical protein POPTR_0007s13120g [Populus t... 129 2e-33 OMO56932.1 hypothetical protein CCACVL1_26145 [Corchorus capsula... 129 3e-33 XP_003519893.2 PREDICTED: auxilin-like protein 1 [Glycine max] K... 129 4e-33 XP_007156063.1 hypothetical protein PHAVU_003G255200g [Phaseolus... 128 5e-33 XP_007156064.1 hypothetical protein PHAVU_003G255200g [Phaseolus... 128 5e-33 KOM32282.1 hypothetical protein LR48_Vigan01g183800 [Vigna angul... 128 5e-33 XP_014510655.1 PREDICTED: auxilin-like protein 1 [Vigna radiata ... 128 5e-33 BAT75459.1 hypothetical protein VIGAN_01332600 [Vigna angularis ... 128 5e-33 XP_017418106.1 PREDICTED: auxilin-like protein 1 [Vigna angularis] 128 5e-33 XP_004287878.1 PREDICTED: auxilin-like protein 1 [Fragaria vesca... 128 5e-33 XP_015890020.1 PREDICTED: auxilin-like protein 1 [Ziziphus jujuba] 128 5e-33 GAV60012.1 DnaJ domain-containing protein [Cephalotus follicularis] 128 7e-33 XP_018829451.1 PREDICTED: auxilin-like protein 1 [Juglans regia] 128 7e-33 OMO84437.1 hypothetical protein COLO4_22044 [Corchorus olitorius] 128 7e-33 KCW60593.1 hypothetical protein EUGRSUZ_H03319 [Eucalyptus grandis] 127 9e-33 >XP_006599370.1 PREDICTED: auxilin-related protein 2-like [Glycine max] Length = 114 Score = 124 bits (312), Expect = 1e-35 Identities = 62/68 (91%), Positives = 65/68 (95%) Frame = +1 Query: 1 MRDLLAQKEQAERNKLAETLDAEVRRWSSGKEGNLRALLSTLQYILGHDSGWQPIPLTEV 180 MRDL+AQKEQAERN+LAETLD EVRRWSSGKEGNLRALLSTL YILG DSGWQPIPLT+V Sbjct: 1 MRDLVAQKEQAERNRLAETLDTEVRRWSSGKEGNLRALLSTLLYILGPDSGWQPIPLTDV 60 Query: 181 ITSAAVKK 204 ITSAAVKK Sbjct: 61 ITSAAVKK 68 >XP_012573701.1 PREDICTED: auxilin-like protein 1 [Cicer arietinum] Length = 1447 Score = 131 bits (329), Expect = 6e-34 Identities = 64/69 (92%), Positives = 68/69 (98%) Frame = +1 Query: 1 MRDLLAQKEQAERNKLAETLDAEVRRWSSGKEGNLRALLSTLQYILGHDSGWQPIPLTEV 180 MRDL+AQKEQAER++LAETLD EV+RWSSGKEGNLRALLSTLQYILGHDSGWQPIPLTEV Sbjct: 1334 MRDLIAQKEQAERSRLAETLDTEVKRWSSGKEGNLRALLSTLQYILGHDSGWQPIPLTEV 1393 Query: 181 ITSAAVKKA 207 ITSAAVKKA Sbjct: 1394 ITSAAVKKA 1402 >KHN11110.1 Auxilin-related protein 1 [Glycine soja] Length = 488 Score = 129 bits (323), Expect = 9e-34 Identities = 64/69 (92%), Positives = 67/69 (97%) Frame = +1 Query: 1 MRDLLAQKEQAERNKLAETLDAEVRRWSSGKEGNLRALLSTLQYILGHDSGWQPIPLTEV 180 MRDL+AQKEQAERN+LAETLD EVRRWSSGKEGNLRALLSTLQYILG DSGWQPIPLT+V Sbjct: 375 MRDLVAQKEQAERNRLAETLDTEVRRWSSGKEGNLRALLSTLQYILGPDSGWQPIPLTDV 434 Query: 181 ITSAAVKKA 207 ITSAAVKKA Sbjct: 435 ITSAAVKKA 443 >XP_019056908.1 PREDICTED: auxilin-like protein 1 isoform X1 [Tarenaya hassleriana] XP_019056909.1 PREDICTED: auxilin-like protein 1 isoform X1 [Tarenaya hassleriana] Length = 1274 Score = 130 bits (327), Expect = 1e-33 Identities = 62/69 (89%), Positives = 69/69 (100%) Frame = +1 Query: 1 MRDLLAQKEQAERNKLAETLDAEVRRWSSGKEGNLRALLSTLQYILGHDSGWQPIPLTEV 180 MRDL+AQ+EQAERN+LAETLDAEV+RWSSGKEGN+RALLSTLQY+LGH+SGWQPIPLTEV Sbjct: 1161 MRDLVAQREQAERNRLAETLDAEVKRWSSGKEGNIRALLSTLQYVLGHESGWQPIPLTEV 1220 Query: 181 ITSAAVKKA 207 ITSAAVKKA Sbjct: 1221 ITSAAVKKA 1229 >XP_019056910.1 PREDICTED: trichohyalin isoform X2 [Tarenaya hassleriana] Length = 1130 Score = 130 bits (327), Expect = 1e-33 Identities = 62/69 (89%), Positives = 69/69 (100%) Frame = +1 Query: 1 MRDLLAQKEQAERNKLAETLDAEVRRWSSGKEGNLRALLSTLQYILGHDSGWQPIPLTEV 180 MRDL+AQ+EQAERN+LAETLDAEV+RWSSGKEGN+RALLSTLQY+LGH+SGWQPIPLTEV Sbjct: 1017 MRDLVAQREQAERNRLAETLDAEVKRWSSGKEGNIRALLSTLQYVLGHESGWQPIPLTEV 1076 Query: 181 ITSAAVKKA 207 ITSAAVKKA Sbjct: 1077 ITSAAVKKA 1085 >XP_002310250.2 hypothetical protein POPTR_0007s13120g [Populus trichocarpa] EEE90700.2 hypothetical protein POPTR_0007s13120g [Populus trichocarpa] Length = 1478 Score = 129 bits (325), Expect = 2e-33 Identities = 64/69 (92%), Positives = 68/69 (98%) Frame = +1 Query: 1 MRDLLAQKEQAERNKLAETLDAEVRRWSSGKEGNLRALLSTLQYILGHDSGWQPIPLTEV 180 MRDLLAQ+EQAERN+LAETLDA+V+RWSSGKEGNLRALLSTLQYILG DSGWQPIPLTEV Sbjct: 1365 MRDLLAQREQAERNRLAETLDADVKRWSSGKEGNLRALLSTLQYILGSDSGWQPIPLTEV 1424 Query: 181 ITSAAVKKA 207 ITSAAVKKA Sbjct: 1425 ITSAAVKKA 1433 >OMO56932.1 hypothetical protein CCACVL1_26145 [Corchorus capsularis] Length = 1606 Score = 129 bits (324), Expect = 3e-33 Identities = 64/69 (92%), Positives = 68/69 (98%) Frame = +1 Query: 1 MRDLLAQKEQAERNKLAETLDAEVRRWSSGKEGNLRALLSTLQYILGHDSGWQPIPLTEV 180 MRDLLAQ+EQAERN+LAETLDA+V+RWSSGKEGNLRALLSTLQYILG DSGWQPIPLTEV Sbjct: 1493 MRDLLAQREQAERNRLAETLDADVKRWSSGKEGNLRALLSTLQYILGPDSGWQPIPLTEV 1552 Query: 181 ITSAAVKKA 207 ITSAAVKKA Sbjct: 1553 ITSAAVKKA 1561 >XP_003519893.2 PREDICTED: auxilin-like protein 1 [Glycine max] KRH69887.1 hypothetical protein GLYMA_02G055100 [Glycine max] Length = 1440 Score = 129 bits (323), Expect = 4e-33 Identities = 64/69 (92%), Positives = 67/69 (97%) Frame = +1 Query: 1 MRDLLAQKEQAERNKLAETLDAEVRRWSSGKEGNLRALLSTLQYILGHDSGWQPIPLTEV 180 MRDL+AQKEQAERN+LAETLD EVRRWSSGKEGNLRALLSTLQYILG DSGWQPIPLT+V Sbjct: 1327 MRDLVAQKEQAERNRLAETLDTEVRRWSSGKEGNLRALLSTLQYILGPDSGWQPIPLTDV 1386 Query: 181 ITSAAVKKA 207 ITSAAVKKA Sbjct: 1387 ITSAAVKKA 1395 >XP_007156063.1 hypothetical protein PHAVU_003G255200g [Phaseolus vulgaris] ESW28057.1 hypothetical protein PHAVU_003G255200g [Phaseolus vulgaris] Length = 1421 Score = 128 bits (322), Expect = 5e-33 Identities = 64/69 (92%), Positives = 67/69 (97%) Frame = +1 Query: 1 MRDLLAQKEQAERNKLAETLDAEVRRWSSGKEGNLRALLSTLQYILGHDSGWQPIPLTEV 180 MRDL+AQKEQAERN+LAETLD EVRRWSSGKEGNLRALLSTLQYILG DSGWQPIPLT+V Sbjct: 1308 MRDLVAQKEQAERNRLAETLDIEVRRWSSGKEGNLRALLSTLQYILGPDSGWQPIPLTDV 1367 Query: 181 ITSAAVKKA 207 ITSAAVKKA Sbjct: 1368 ITSAAVKKA 1376 >XP_007156064.1 hypothetical protein PHAVU_003G255200g [Phaseolus vulgaris] ESW28058.1 hypothetical protein PHAVU_003G255200g [Phaseolus vulgaris] Length = 1422 Score = 128 bits (322), Expect = 5e-33 Identities = 64/69 (92%), Positives = 67/69 (97%) Frame = +1 Query: 1 MRDLLAQKEQAERNKLAETLDAEVRRWSSGKEGNLRALLSTLQYILGHDSGWQPIPLTEV 180 MRDL+AQKEQAERN+LAETLD EVRRWSSGKEGNLRALLSTLQYILG DSGWQPIPLT+V Sbjct: 1309 MRDLVAQKEQAERNRLAETLDIEVRRWSSGKEGNLRALLSTLQYILGPDSGWQPIPLTDV 1368 Query: 181 ITSAAVKKA 207 ITSAAVKKA Sbjct: 1369 ITSAAVKKA 1377 >KOM32282.1 hypothetical protein LR48_Vigan01g183800 [Vigna angularis] Length = 1476 Score = 128 bits (322), Expect = 5e-33 Identities = 64/69 (92%), Positives = 67/69 (97%) Frame = +1 Query: 1 MRDLLAQKEQAERNKLAETLDAEVRRWSSGKEGNLRALLSTLQYILGHDSGWQPIPLTEV 180 MRDL+AQKEQAERN+LAETLD EVRRWSSGKEGNLRALLSTLQYILG DSGWQPIPLT+V Sbjct: 1361 MRDLVAQKEQAERNRLAETLDIEVRRWSSGKEGNLRALLSTLQYILGPDSGWQPIPLTDV 1420 Query: 181 ITSAAVKKA 207 ITSAAVKKA Sbjct: 1421 ITSAAVKKA 1429 >XP_014510655.1 PREDICTED: auxilin-like protein 1 [Vigna radiata var. radiata] Length = 1485 Score = 128 bits (322), Expect = 5e-33 Identities = 64/69 (92%), Positives = 67/69 (97%) Frame = +1 Query: 1 MRDLLAQKEQAERNKLAETLDAEVRRWSSGKEGNLRALLSTLQYILGHDSGWQPIPLTEV 180 MRDL+AQKEQAERN+LAETLD EVRRWSSGKEGNLRALLSTLQYILG DSGWQPIPLT+V Sbjct: 1372 MRDLVAQKEQAERNRLAETLDIEVRRWSSGKEGNLRALLSTLQYILGPDSGWQPIPLTDV 1431 Query: 181 ITSAAVKKA 207 ITSAAVKKA Sbjct: 1432 ITSAAVKKA 1440 >BAT75459.1 hypothetical protein VIGAN_01332600 [Vigna angularis var. angularis] Length = 1487 Score = 128 bits (322), Expect = 5e-33 Identities = 64/69 (92%), Positives = 67/69 (97%) Frame = +1 Query: 1 MRDLLAQKEQAERNKLAETLDAEVRRWSSGKEGNLRALLSTLQYILGHDSGWQPIPLTEV 180 MRDL+AQKEQAERN+LAETLD EVRRWSSGKEGNLRALLSTLQYILG DSGWQPIPLT+V Sbjct: 1372 MRDLVAQKEQAERNRLAETLDIEVRRWSSGKEGNLRALLSTLQYILGPDSGWQPIPLTDV 1431 Query: 181 ITSAAVKKA 207 ITSAAVKKA Sbjct: 1432 ITSAAVKKA 1440 >XP_017418106.1 PREDICTED: auxilin-like protein 1 [Vigna angularis] Length = 1488 Score = 128 bits (322), Expect = 5e-33 Identities = 64/69 (92%), Positives = 67/69 (97%) Frame = +1 Query: 1 MRDLLAQKEQAERNKLAETLDAEVRRWSSGKEGNLRALLSTLQYILGHDSGWQPIPLTEV 180 MRDL+AQKEQAERN+LAETLD EVRRWSSGKEGNLRALLSTLQYILG DSGWQPIPLT+V Sbjct: 1375 MRDLVAQKEQAERNRLAETLDIEVRRWSSGKEGNLRALLSTLQYILGPDSGWQPIPLTDV 1434 Query: 181 ITSAAVKKA 207 ITSAAVKKA Sbjct: 1435 ITSAAVKKA 1443 >XP_004287878.1 PREDICTED: auxilin-like protein 1 [Fragaria vesca subsp. vesca] Length = 1511 Score = 128 bits (322), Expect = 5e-33 Identities = 63/69 (91%), Positives = 68/69 (98%) Frame = +1 Query: 1 MRDLLAQKEQAERNKLAETLDAEVRRWSSGKEGNLRALLSTLQYILGHDSGWQPIPLTEV 180 MRDLLAQ+EQAERN+LAETLDA+V+RWSSGKEGNLRALLSTLQYILG DSGWQPIPLTEV Sbjct: 1398 MRDLLAQREQAERNRLAETLDADVKRWSSGKEGNLRALLSTLQYILGSDSGWQPIPLTEV 1457 Query: 181 ITSAAVKKA 207 IT+AAVKKA Sbjct: 1458 ITAAAVKKA 1466 >XP_015890020.1 PREDICTED: auxilin-like protein 1 [Ziziphus jujuba] Length = 1513 Score = 128 bits (322), Expect = 5e-33 Identities = 63/69 (91%), Positives = 68/69 (98%) Frame = +1 Query: 1 MRDLLAQKEQAERNKLAETLDAEVRRWSSGKEGNLRALLSTLQYILGHDSGWQPIPLTEV 180 MRDLLAQ+EQAERN++AETLDA+VRRWSSGKEGNLRALLSTLQYILG DSGWQPIPLTEV Sbjct: 1400 MRDLLAQREQAERNRIAETLDADVRRWSSGKEGNLRALLSTLQYILGPDSGWQPIPLTEV 1459 Query: 181 ITSAAVKKA 207 IT+AAVKKA Sbjct: 1460 ITAAAVKKA 1468 >GAV60012.1 DnaJ domain-containing protein [Cephalotus follicularis] Length = 1500 Score = 128 bits (321), Expect = 7e-33 Identities = 63/69 (91%), Positives = 68/69 (98%) Frame = +1 Query: 1 MRDLLAQKEQAERNKLAETLDAEVRRWSSGKEGNLRALLSTLQYILGHDSGWQPIPLTEV 180 MRDLLAQ+EQAERN+LAETLDA+V+RWSSGKEGNLRALLSTLQYILG DSGWQPIPLTEV Sbjct: 1387 MRDLLAQREQAERNRLAETLDADVKRWSSGKEGNLRALLSTLQYILGPDSGWQPIPLTEV 1446 Query: 181 ITSAAVKKA 207 IT+AAVKKA Sbjct: 1447 ITAAAVKKA 1455 >XP_018829451.1 PREDICTED: auxilin-like protein 1 [Juglans regia] Length = 1468 Score = 128 bits (321), Expect = 7e-33 Identities = 63/69 (91%), Positives = 68/69 (98%) Frame = +1 Query: 1 MRDLLAQKEQAERNKLAETLDAEVRRWSSGKEGNLRALLSTLQYILGHDSGWQPIPLTEV 180 MRDLLAQ+EQAERN+LAETLDA+VRRWS+GKEGNLRALLSTLQYILG DSGWQPIPLTEV Sbjct: 1355 MRDLLAQREQAERNRLAETLDADVRRWSNGKEGNLRALLSTLQYILGPDSGWQPIPLTEV 1414 Query: 181 ITSAAVKKA 207 IT+AAVKKA Sbjct: 1415 ITAAAVKKA 1423 >OMO84437.1 hypothetical protein COLO4_22044 [Corchorus olitorius] Length = 1421 Score = 128 bits (321), Expect = 7e-33 Identities = 63/69 (91%), Positives = 68/69 (98%) Frame = +1 Query: 1 MRDLLAQKEQAERNKLAETLDAEVRRWSSGKEGNLRALLSTLQYILGHDSGWQPIPLTEV 180 MRDLLAQ+EQAERN+LAETLDA+V+RWS+GKEGNLRALLSTLQYILG DSGWQPIPLTEV Sbjct: 1308 MRDLLAQREQAERNRLAETLDADVKRWSNGKEGNLRALLSTLQYILGPDSGWQPIPLTEV 1367 Query: 181 ITSAAVKKA 207 ITSAAVKKA Sbjct: 1368 ITSAAVKKA 1376 >KCW60593.1 hypothetical protein EUGRSUZ_H03319 [Eucalyptus grandis] Length = 1289 Score = 127 bits (320), Expect = 9e-33 Identities = 62/69 (89%), Positives = 68/69 (98%) Frame = +1 Query: 1 MRDLLAQKEQAERNKLAETLDAEVRRWSSGKEGNLRALLSTLQYILGHDSGWQPIPLTEV 180 MRDLLAQ+EQAERN+LAETLDA+V+RWSSGKEGNLRALLSTLQYILG DSGWQP+PLTEV Sbjct: 1176 MRDLLAQREQAERNRLAETLDADVKRWSSGKEGNLRALLSTLQYILGPDSGWQPVPLTEV 1235 Query: 181 ITSAAVKKA 207 ITSAAVK+A Sbjct: 1236 ITSAAVKRA 1244