BLASTX nr result
ID: Glycyrrhiza29_contig00037538
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza29_contig00037538 (262 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_013461772.1 galactose oxidase [Medicago truncatula] KEH35807.... 73 3e-13 GAU36491.1 hypothetical protein TSUD_316170 [Trifolium subterran... 64 5e-10 GAU19173.1 hypothetical protein TSUD_198540 [Trifolium subterran... 62 2e-09 XP_013444165.1 galactose oxidase [Medicago truncatula] KEH18192.... 57 4e-09 XP_003599499.1 galactose oxidase [Medicago truncatula] AES69750.... 61 5e-09 GAU19780.1 hypothetical protein TSUD_182150 [Trifolium subterran... 61 6e-09 XP_003605059.1 galactose oxidase [Medicago truncatula] AES87256.... 60 8e-09 ADD09580.1 galactose oxidase [Trifolium repens] 60 8e-09 ADD09566.1 galactose oxidase [Trifolium repens] 60 9e-09 GAU19178.1 hypothetical protein TSUD_198590 [Trifolium subterran... 60 1e-08 GAU16715.1 hypothetical protein TSUD_199570 [Trifolium subterran... 59 2e-08 GAU19174.1 hypothetical protein TSUD_198550 [Trifolium subterran... 59 3e-08 XP_003596011.2 galactose oxidase, putative [Medicago truncatula]... 55 3e-08 XP_013457954.1 F-box protein interaction domain protein [Medicag... 59 4e-08 XP_003617942.2 F-box protein interaction domain protein [Medicag... 57 1e-07 KHN02962.1 F-box/kelch-repeat protein [Glycine soja] 57 1e-07 XP_003528639.1 PREDICTED: F-box/kelch-repeat protein At3g06240-l... 57 2e-07 XP_003599498.1 galactose oxidase [Medicago truncatula] AES69749.... 57 2e-07 XP_013458204.1 F-box protein interaction domain protein [Medicag... 57 2e-07 GAU41605.1 hypothetical protein TSUD_196750 [Trifolium subterran... 57 2e-07 >XP_013461772.1 galactose oxidase [Medicago truncatula] KEH35807.1 galactose oxidase [Medicago truncatula] Length = 378 Score = 73.2 bits (178), Expect = 3e-13 Identities = 37/51 (72%), Positives = 40/51 (78%) Frame = -1 Query: 262 TDGGTGLVKYNCNGQLLEYRSYCNDPNVPRECQVAMYTETLLSLPGGSEQA 110 TD TGLVKYN GQLLE+RSYCND P CQV MYTE+LLSLPG +EQA Sbjct: 331 TDDDTGLVKYNDKGQLLEHRSYCND---PCGCQVVMYTESLLSLPGDNEQA 378 >GAU36491.1 hypothetical protein TSUD_316170 [Trifolium subterraneum] Length = 378 Score = 63.9 bits (154), Expect = 5e-10 Identities = 32/51 (62%), Positives = 40/51 (78%) Frame = -1 Query: 262 TDGGTGLVKYNCNGQLLEYRSYCNDPNVPRECQVAMYTETLLSLPGGSEQA 110 TDG TGLVKYN G+LLE+RSYC+D +VA+Y+E+LLSLP G+EQA Sbjct: 331 TDGVTGLVKYNDKGRLLEHRSYCSD---QYRSEVALYSESLLSLPNGNEQA 378 >GAU19173.1 hypothetical protein TSUD_198540 [Trifolium subterraneum] Length = 369 Score = 62.0 bits (149), Expect = 2e-09 Identities = 32/50 (64%), Positives = 36/50 (72%) Frame = -1 Query: 262 TDGGTGLVKYNCNGQLLEYRSYCNDPNVPRECQVAMYTETLLSLPGGSEQ 113 T GGTGLVKYN GQ+L + YC+D PR QV MYTE+LLSLPG EQ Sbjct: 322 TIGGTGLVKYNGKGQMLGHCCYCDD---PRGSQVVMYTESLLSLPGNHEQ 368 >XP_013444165.1 galactose oxidase [Medicago truncatula] KEH18192.1 galactose oxidase [Medicago truncatula] Length = 59 Score = 57.0 bits (136), Expect = 4e-09 Identities = 32/51 (62%), Positives = 36/51 (70%) Frame = -1 Query: 262 TDGGTGLVKYNCNGQLLEYRSYCNDPNVPRECQVAMYTETLLSLPGGSEQA 110 T GGT LVKY+ GQLLE+R Y ND QV MYTE+LLSLPG +EQA Sbjct: 12 TYGGTELVKYDDKGQLLEHRCYYND---GFGSQVTMYTESLLSLPGNNEQA 59 >XP_003599499.1 galactose oxidase [Medicago truncatula] AES69750.1 galactose oxidase [Medicago truncatula] Length = 489 Score = 61.2 bits (147), Expect = 5e-09 Identities = 35/49 (71%), Positives = 37/49 (75%), Gaps = 2/49 (4%) Frame = -1 Query: 253 GTGLVKYNCNGQLLEYRSYCNDPNVPREC--QVAMYTETLLSLPGGSEQ 113 GTGLVKY+ NGQLLE RSY NDP C VAMYTE+LLSLPG SEQ Sbjct: 445 GTGLVKYDGNGQLLENRSYYNDP-----CGRLVAMYTESLLSLPGDSEQ 488 >GAU19780.1 hypothetical protein TSUD_182150 [Trifolium subterraneum] Length = 380 Score = 60.8 bits (146), Expect = 6e-09 Identities = 30/51 (58%), Positives = 40/51 (78%) Frame = -1 Query: 262 TDGGTGLVKYNCNGQLLEYRSYCNDPNVPRECQVAMYTETLLSLPGGSEQA 110 +DG +GLVK+N GQ+LEYRSY N + PR +A+YTE+LL+LP G+EQA Sbjct: 327 SDGNSGLVKFNDKGQMLEYRSYRNRLSEPR--YIAVYTESLLALPSGTEQA 375 >XP_003605059.1 galactose oxidase [Medicago truncatula] AES87256.1 galactose oxidase [Medicago truncatula] Length = 222 Score = 59.7 bits (143), Expect = 8e-09 Identities = 29/47 (61%), Positives = 34/47 (72%) Frame = -1 Query: 253 GTGLVKYNCNGQLLEYRSYCNDPNVPRECQVAMYTETLLSLPGGSEQ 113 G+ LVKYN GQLL +RS CN P P +V MYTE+LLSLPG +EQ Sbjct: 175 GSRLVKYNDEGQLLRHRSICNSPFEPAMYRVVMYTESLLSLPGDNEQ 221 >ADD09580.1 galactose oxidase [Trifolium repens] Length = 353 Score = 60.5 bits (145), Expect = 8e-09 Identities = 30/49 (61%), Positives = 38/49 (77%) Frame = -1 Query: 259 DGGTGLVKYNCNGQLLEYRSYCNDPNVPRECQVAMYTETLLSLPGGSEQ 113 DG TGL+KYN GQLLE+RSYCND ++A+Y+E+LLSLP G+EQ Sbjct: 307 DGVTGLLKYNDKGQLLEHRSYCND---LYRSEMALYSESLLSLPDGNEQ 352 >ADD09566.1 galactose oxidase [Trifolium repens] Length = 377 Score = 60.5 bits (145), Expect = 9e-09 Identities = 30/49 (61%), Positives = 38/49 (77%) Frame = -1 Query: 259 DGGTGLVKYNCNGQLLEYRSYCNDPNVPRECQVAMYTETLLSLPGGSEQ 113 DG TGL+KYN GQLLE+RSYCND ++A+Y+E+LLSLP G+EQ Sbjct: 331 DGVTGLLKYNDKGQLLEHRSYCND---LYRSEMALYSESLLSLPDGNEQ 376 >GAU19178.1 hypothetical protein TSUD_198590 [Trifolium subterraneum] Length = 366 Score = 60.1 bits (144), Expect = 1e-08 Identities = 31/50 (62%), Positives = 35/50 (70%) Frame = -1 Query: 262 TDGGTGLVKYNCNGQLLEYRSYCNDPNVPRECQVAMYTETLLSLPGGSEQ 113 T GGTGLVKYN GQLL + SYC D PR QV MYTE+LLSLP ++ Sbjct: 319 TIGGTGLVKYNGKGQLLGHCSYCED---PRRSQVIMYTESLLSLPDNKQE 365 >GAU16715.1 hypothetical protein TSUD_199570 [Trifolium subterraneum] Length = 373 Score = 59.3 bits (142), Expect = 2e-08 Identities = 31/47 (65%), Positives = 35/47 (74%) Frame = -1 Query: 253 GTGLVKYNCNGQLLEYRSYCNDPNVPRECQVAMYTETLLSLPGGSEQ 113 GTGLVKYN GQLL + SYCND R QV MYTE+LLSLPG S++ Sbjct: 329 GTGLVKYNGKGQLLGHCSYCND---SRGSQVVMYTESLLSLPGDSKE 372 >GAU19174.1 hypothetical protein TSUD_198550 [Trifolium subterraneum] Length = 364 Score = 58.9 bits (141), Expect = 3e-08 Identities = 31/50 (62%), Positives = 35/50 (70%) Frame = -1 Query: 262 TDGGTGLVKYNCNGQLLEYRSYCNDPNVPRECQVAMYTETLLSLPGGSEQ 113 T GGTGLVKYN GQ+L + YC+D PR QV MYTE+LLSLPG Q Sbjct: 317 TIGGTGLVKYNGKGQMLGHCCYCDD---PRGSQVVMYTESLLSLPGDHGQ 363 >XP_003596011.2 galactose oxidase, putative [Medicago truncatula] AES66262.2 galactose oxidase, putative [Medicago truncatula] Length = 59 Score = 54.7 bits (130), Expect = 3e-08 Identities = 30/51 (58%), Positives = 35/51 (68%) Frame = -1 Query: 262 TDGGTGLVKYNCNGQLLEYRSYCNDPNVPRECQVAMYTETLLSLPGGSEQA 110 TDGGT LVKY GQLLE+R Y ND +V MY E++LSLPG +EQA Sbjct: 12 TDGGTELVKYYDKGQLLEHRCYYND---GCGSEVVMYRESMLSLPGDNEQA 59 >XP_013457954.1 F-box protein interaction domain protein [Medicago truncatula] KEH31985.1 F-box protein interaction domain protein [Medicago truncatula] Length = 364 Score = 58.5 bits (140), Expect = 4e-08 Identities = 32/51 (62%), Positives = 38/51 (74%) Frame = -1 Query: 262 TDGGTGLVKYNCNGQLLEYRSYCNDPNVPRECQVAMYTETLLSLPGGSEQA 110 TD LVKYN GQLL +RSY ++ R+CQVAMYTE+LLSLPG +EQA Sbjct: 317 TDDLNRLVKYNDEGQLLGHRSYYDNL---RQCQVAMYTESLLSLPGDNEQA 364 >XP_003617942.2 F-box protein interaction domain protein [Medicago truncatula] AET00901.2 F-box protein interaction domain protein [Medicago truncatula] Length = 374 Score = 57.4 bits (137), Expect = 1e-07 Identities = 29/45 (64%), Positives = 34/45 (75%) Frame = -1 Query: 262 TDGGTGLVKYNCNGQLLEYRSYCNDPNVPRECQVAMYTETLLSLP 128 TDGGTGLVKYN G+ LE+ SYC D + R +AMYTE+LLSLP Sbjct: 316 TDGGTGLVKYNDKGEFLEHNSYCEDAHGFR---LAMYTESLLSLP 357 >KHN02962.1 F-box/kelch-repeat protein [Glycine soja] Length = 228 Score = 56.6 bits (135), Expect = 1e-07 Identities = 32/54 (59%), Positives = 37/54 (68%) Frame = -1 Query: 262 TDGGTGLVKYNCNGQLLEYRSYCNDPNVPRECQVAMYTETLLSLPGGSEQA*ED 101 TDG GL K N GQLLEYRSY N + QVA+Y+++LLSLP SEQA ED Sbjct: 176 TDGRAGLTKCNNEGQLLEYRSYSNSSR--GQHQVAVYSDSLLSLPCDSEQAEED 227 >XP_003528639.1 PREDICTED: F-box/kelch-repeat protein At3g06240-like [Glycine max] KRH50837.1 hypothetical protein GLYMA_07G247000 [Glycine max] Length = 375 Score = 56.6 bits (135), Expect = 2e-07 Identities = 32/54 (59%), Positives = 37/54 (68%) Frame = -1 Query: 262 TDGGTGLVKYNCNGQLLEYRSYCNDPNVPRECQVAMYTETLLSLPGGSEQA*ED 101 TDG GL K N GQLLEYRSY N + QVA+Y+++LLSLP SEQA ED Sbjct: 323 TDGRAGLTKCNNEGQLLEYRSYSNSSR--GQHQVAVYSDSLLSLPCDSEQAEED 374 >XP_003599498.1 galactose oxidase [Medicago truncatula] AES69749.1 galactose oxidase [Medicago truncatula] Length = 375 Score = 56.6 bits (135), Expect = 2e-07 Identities = 32/50 (64%), Positives = 35/50 (70%) Frame = -1 Query: 262 TDGGTGLVKYNCNGQLLEYRSYCNDPNVPRECQVAMYTETLLSLPGGSEQ 113 T+GG LVKY+ NGQLLE RSY NDP V MYTE+LLSLPG S Q Sbjct: 329 TNGGGELVKYDGNGQLLENRSYFNDPC----ALVVMYTESLLSLPGDSGQ 374 >XP_013458204.1 F-box protein interaction domain protein [Medicago truncatula] KEH32235.1 F-box protein interaction domain protein [Medicago truncatula] Length = 378 Score = 56.6 bits (135), Expect = 2e-07 Identities = 30/49 (61%), Positives = 35/49 (71%), Gaps = 2/49 (4%) Frame = -1 Query: 262 TDGGTGLVKYNCNGQLLEYRSYCNDPNV-PREC-QVAMYTETLLSLPGG 122 TDG +GLVKY+ G LLE+RSYC N P C QVA+YTE+LLS P G Sbjct: 325 TDGDSGLVKYDGEGHLLEHRSYCKKNNTWPSFCSQVAIYTESLLSFPSG 373 >GAU41605.1 hypothetical protein TSUD_196750 [Trifolium subterraneum] Length = 379 Score = 56.6 bits (135), Expect = 2e-07 Identities = 30/46 (65%), Positives = 33/46 (71%) Frame = -1 Query: 247 GLVKYNCNGQLLEYRSYCNDPNVPRECQVAMYTETLLSLPGGSEQA 110 GL KYN GQLLEY SYCND P Q+A+Y E+LLSLP SEQA Sbjct: 337 GLGKYNDKGQLLEYHSYCND---PYGSQMALYIESLLSLPPDSEQA 379