BLASTX nr result
ID: Glycyrrhiza29_contig00037474
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza29_contig00037474 (506 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_004487033.1 PREDICTED: methyl-CpG-binding domain-containing p... 99 2e-22 GAU27212.1 hypothetical protein TSUD_108030 [Trifolium subterran... 94 4e-20 XP_013465377.1 methyl-CpG-binding domain protein [Medicago trunc... 92 4e-20 KRH10296.1 hypothetical protein GLYMA_15G040900 [Glycine max] 91 7e-20 KRH48881.1 hypothetical protein GLYMA_07G118700 [Glycine max] 90 7e-20 XP_003597337.2 methyl-CpG-binding domain protein [Medicago trunc... 92 2e-19 XP_006583514.1 PREDICTED: methyl-CpG-binding domain-containing p... 90 3e-19 XP_003529018.1 PREDICTED: methyl-CpG-binding domain-containing p... 90 6e-19 XP_016172095.1 PREDICTED: methyl-CpG-binding domain-containing p... 90 6e-19 KHN01604.1 Methyl-CpG-binding domain-containing protein 7 [Glyci... 90 1e-18 XP_014620665.1 PREDICTED: uncharacterized protein LOC100779601 i... 89 2e-18 NP_001242214.1 uncharacterized protein LOC100779601 [Glycine max... 89 3e-18 XP_015935702.1 PREDICTED: methyl-CpG-binding domain-containing p... 88 3e-18 XP_006593405.1 PREDICTED: uncharacterized protein LOC100779601 i... 89 4e-18 KYP58565.1 hypothetical protein KK1_013979, partial [Cajanus cajan] 86 2e-17 XP_003597335.2 ribosomal protein L5 [Medicago truncatula] AES675... 85 4e-17 XP_013454611.1 methyl-CpG-binding domain protein [Medicago trunc... 85 4e-17 ABN06005.1 Methyl-CpG binding, putative [Medicago truncatula] 85 6e-17 XP_019436228.1 PREDICTED: methyl-CpG-binding domain-containing p... 82 6e-16 XP_019436225.1 PREDICTED: methyl-CpG-binding domain-containing p... 82 6e-16 >XP_004487033.1 PREDICTED: methyl-CpG-binding domain-containing protein 7 [Cicer arietinum] Length = 222 Score = 98.6 bits (244), Expect = 2e-22 Identities = 41/55 (74%), Positives = 49/55 (89%) Frame = +1 Query: 1 DRGSIHNLPRPPAKVSWVLSGPGGFWSPFVDDSTVPECEKLKWSEAFVQSIHEGI 165 DRGS+HNL RPP KVSWVL+GPGG W+PF+DDS VPE EKLKWS+AF+ SI+EG+ Sbjct: 166 DRGSVHNLTRPPTKVSWVLAGPGGLWNPFLDDSLVPESEKLKWSKAFITSINEGV 220 >GAU27212.1 hypothetical protein TSUD_108030 [Trifolium subterraneum] Length = 308 Score = 94.4 bits (233), Expect = 4e-20 Identities = 42/56 (75%), Positives = 46/56 (82%) Frame = +1 Query: 4 RGSIHNLPRPPAKVSWVLSGPGGFWSPFVDDSTVPECEKLKWSEAFVQSIHEGIIN 171 RGSIHNL RPP KVSWVLSGPGG W+PF+DDS VP EK KWSEAF SI+EG+ N Sbjct: 253 RGSIHNLTRPPTKVSWVLSGPGGLWNPFLDDSIVPASEKAKWSEAFSISINEGVTN 308 >XP_013465377.1 methyl-CpG-binding domain protein [Medicago truncatula] KEH39412.1 methyl-CpG-binding domain protein [Medicago truncatula] Length = 204 Score = 92.0 bits (227), Expect = 4e-20 Identities = 42/58 (72%), Positives = 46/58 (79%) Frame = +1 Query: 1 DRGSIHNLPRPPAKVSWVLSGPGGFWSPFVDDSTVPECEKLKWSEAFVQSIHEGIING 174 DRGSIHNL RPP KVSWVLS P GFW+PF+DDS VP EK KWSEAF SI+EG +G Sbjct: 144 DRGSIHNLARPPTKVSWVLSDPRGFWNPFLDDSVVPASEKRKWSEAFSISINEGATSG 201 >KRH10296.1 hypothetical protein GLYMA_15G040900 [Glycine max] Length = 180 Score = 90.9 bits (224), Expect = 7e-20 Identities = 45/60 (75%), Positives = 50/60 (83%), Gaps = 2/60 (3%) Frame = +1 Query: 1 DRGSIHNLPRPP-AKVSWVLSGPGGFWSPFVDDSTVPECEKLKWSEAFVQSIH-EGIING 174 +R S+HNL PP AKVSWVLS PGGFWSPF+DDS VPE EKLKWS+AFV SIH +G ING Sbjct: 118 NRASMHNLTAPPPAKVSWVLSSPGGFWSPFLDDSIVPESEKLKWSKAFVLSIHDDGGING 177 >KRH48881.1 hypothetical protein GLYMA_07G118700 [Glycine max] Length = 154 Score = 90.1 bits (222), Expect = 7e-20 Identities = 44/59 (74%), Positives = 49/59 (83%), Gaps = 2/59 (3%) Frame = +1 Query: 1 DRGSIHNLPRPP-AKVSWVLSGPGGFWSPFVDDSTVPECEKLKWSEAFVQSIH-EGIIN 171 +R S+HNL PP AKVSWVLSGPGGFWSP +DDS VPE EKLKWSEAFV SIH +G+ N Sbjct: 95 NRASMHNLTAPPPAKVSWVLSGPGGFWSPSLDDSIVPESEKLKWSEAFVLSIHNDGVTN 153 >XP_003597337.2 methyl-CpG-binding domain protein [Medicago truncatula] ABD32284.2 Methyl-CpG binding [Medicago truncatula] AFK39448.1 unknown [Medicago truncatula] AES67588.2 methyl-CpG-binding domain protein [Medicago truncatula] Length = 286 Score = 92.0 bits (227), Expect = 2e-19 Identities = 42/58 (72%), Positives = 46/58 (79%) Frame = +1 Query: 1 DRGSIHNLPRPPAKVSWVLSGPGGFWSPFVDDSTVPECEKLKWSEAFVQSIHEGIING 174 DRGSIHNL RPP KVSWVLS P GFW+PF+DDS VP EK KWSEAF SI+EG +G Sbjct: 226 DRGSIHNLARPPTKVSWVLSDPRGFWNPFLDDSVVPASEKRKWSEAFSISINEGATSG 283 >XP_006583514.1 PREDICTED: methyl-CpG-binding domain-containing protein 7-like isoform X2 [Glycine max] KRH48878.1 hypothetical protein GLYMA_07G118700 [Glycine max] KRH48879.1 hypothetical protein GLYMA_07G118700 [Glycine max] KRH48880.1 hypothetical protein GLYMA_07G118700 [Glycine max] Length = 217 Score = 90.1 bits (222), Expect = 3e-19 Identities = 44/59 (74%), Positives = 49/59 (83%), Gaps = 2/59 (3%) Frame = +1 Query: 1 DRGSIHNLPRPP-AKVSWVLSGPGGFWSPFVDDSTVPECEKLKWSEAFVQSIH-EGIIN 171 +R S+HNL PP AKVSWVLSGPGGFWSP +DDS VPE EKLKWSEAFV SIH +G+ N Sbjct: 158 NRASMHNLTAPPPAKVSWVLSGPGGFWSPSLDDSIVPESEKLKWSEAFVLSIHNDGVTN 216 >XP_003529018.1 PREDICTED: methyl-CpG-binding domain-containing protein 7-like isoform X1 [Glycine max] XP_006583513.1 PREDICTED: methyl-CpG-binding domain-containing protein 7-like isoform X1 [Glycine max] KRH48876.1 hypothetical protein GLYMA_07G118700 [Glycine max] KRH48877.1 hypothetical protein GLYMA_07G118700 [Glycine max] Length = 251 Score = 90.1 bits (222), Expect = 6e-19 Identities = 44/59 (74%), Positives = 49/59 (83%), Gaps = 2/59 (3%) Frame = +1 Query: 1 DRGSIHNLPRPP-AKVSWVLSGPGGFWSPFVDDSTVPECEKLKWSEAFVQSIH-EGIIN 171 +R S+HNL PP AKVSWVLSGPGGFWSP +DDS VPE EKLKWSEAFV SIH +G+ N Sbjct: 192 NRASMHNLTAPPPAKVSWVLSGPGGFWSPSLDDSIVPESEKLKWSEAFVLSIHNDGVTN 250 >XP_016172095.1 PREDICTED: methyl-CpG-binding domain-containing protein 7 [Arachis ipaensis] XP_016172096.1 PREDICTED: methyl-CpG-binding domain-containing protein 7 [Arachis ipaensis] Length = 256 Score = 90.1 bits (222), Expect = 6e-19 Identities = 41/52 (78%), Positives = 43/52 (82%) Frame = +1 Query: 1 DRGSIHNLPRPPAKVSWVLSGPGGFWSPFVDDSTVPECEKLKWSEAFVQSIH 156 +R IHNLP PP KV+WVLSGPGGFWSP VDDS V E EKLKWSEAFV SIH Sbjct: 202 NRSYIHNLPPPPEKVTWVLSGPGGFWSPSVDDSVVAESEKLKWSEAFVLSIH 253 >KHN01604.1 Methyl-CpG-binding domain-containing protein 7 [Glycine soja] Length = 282 Score = 90.1 bits (222), Expect = 1e-18 Identities = 44/59 (74%), Positives = 49/59 (83%), Gaps = 2/59 (3%) Frame = +1 Query: 1 DRGSIHNLPRPP-AKVSWVLSGPGGFWSPFVDDSTVPECEKLKWSEAFVQSIH-EGIIN 171 +R S+HNL PP AKVSWVLSGPGGFWSP +DDS VPE EKLKWSEAFV SIH +G+ N Sbjct: 223 NRASMHNLTAPPPAKVSWVLSGPGGFWSPSLDDSIVPESEKLKWSEAFVLSIHNDGVTN 281 >XP_014620665.1 PREDICTED: uncharacterized protein LOC100779601 isoform X2 [Glycine max] Length = 250 Score = 88.6 bits (218), Expect = 2e-18 Identities = 44/60 (73%), Positives = 50/60 (83%), Gaps = 2/60 (3%) Frame = +1 Query: 1 DRGSIHNLP-RPPAKVSWVLSGPGGFWSPFVDDSTVPECEKLKWSEAFVQSIH-EGIING 174 +R S+HNL PPAKVSWVLSG GGFWSPF+DDS VPE EK+KWS+AFV SIH +G ING Sbjct: 188 NRASMHNLTVPPPAKVSWVLSGSGGFWSPFLDDSIVPEPEKMKWSKAFVLSIHDDGDING 247 >NP_001242214.1 uncharacterized protein LOC100779601 [Glycine max] ACU17620.1 unknown [Glycine max] Length = 261 Score = 88.6 bits (218), Expect = 3e-18 Identities = 44/60 (73%), Positives = 50/60 (83%), Gaps = 2/60 (3%) Frame = +1 Query: 1 DRGSIHNLP-RPPAKVSWVLSGPGGFWSPFVDDSTVPECEKLKWSEAFVQSIH-EGIING 174 +R S+HNL PPAKVSWVLSG GGFWSPF+DDS VPE EK+KWS+AFV SIH +G ING Sbjct: 199 NRASMHNLTVPPPAKVSWVLSGSGGFWSPFLDDSIVPEPEKMKWSKAFVLSIHDDGDING 258 >XP_015935702.1 PREDICTED: methyl-CpG-binding domain-containing protein 7 [Arachis duranensis] XP_015935703.1 PREDICTED: methyl-CpG-binding domain-containing protein 7 [Arachis duranensis] Length = 257 Score = 88.2 bits (217), Expect = 3e-18 Identities = 40/52 (76%), Positives = 43/52 (82%) Frame = +1 Query: 1 DRGSIHNLPRPPAKVSWVLSGPGGFWSPFVDDSTVPECEKLKWSEAFVQSIH 156 +R IHNLP PP KV+WVLSGPGGFWSP V+DS V E EKLKWSEAFV SIH Sbjct: 203 NRSYIHNLPPPPEKVTWVLSGPGGFWSPSVNDSVVAESEKLKWSEAFVLSIH 254 >XP_006593405.1 PREDICTED: uncharacterized protein LOC100779601 isoform X1 [Glycine max] XP_006593406.1 PREDICTED: uncharacterized protein LOC100779601 isoform X1 [Glycine max] XP_006593407.1 PREDICTED: uncharacterized protein LOC100779601 isoform X1 [Glycine max] XP_014620661.1 PREDICTED: uncharacterized protein LOC100779601 isoform X1 [Glycine max] XP_014620662.1 PREDICTED: uncharacterized protein LOC100779601 isoform X1 [Glycine max] XP_014620663.1 PREDICTED: uncharacterized protein LOC100779601 isoform X1 [Glycine max] XP_014620664.1 PREDICTED: uncharacterized protein LOC100779601 isoform X1 [Glycine max] KHN30197.1 Methyl-CpG-binding domain-containing protein 7 [Glycine soja] KRH23023.1 hypothetical protein GLYMA_13G333300 [Glycine max] KRH23024.1 hypothetical protein GLYMA_13G333300 [Glycine max] KRH23025.1 hypothetical protein GLYMA_13G333300 [Glycine max] KRH23026.1 hypothetical protein GLYMA_13G333300 [Glycine max] KRH23027.1 hypothetical protein GLYMA_13G333300 [Glycine max] KRH23028.1 hypothetical protein GLYMA_13G333300 [Glycine max] Length = 282 Score = 88.6 bits (218), Expect = 4e-18 Identities = 44/60 (73%), Positives = 50/60 (83%), Gaps = 2/60 (3%) Frame = +1 Query: 1 DRGSIHNLP-RPPAKVSWVLSGPGGFWSPFVDDSTVPECEKLKWSEAFVQSIH-EGIING 174 +R S+HNL PPAKVSWVLSG GGFWSPF+DDS VPE EK+KWS+AFV SIH +G ING Sbjct: 220 NRASMHNLTVPPPAKVSWVLSGSGGFWSPFLDDSIVPEPEKMKWSKAFVLSIHDDGDING 279 >KYP58565.1 hypothetical protein KK1_013979, partial [Cajanus cajan] Length = 227 Score = 85.5 bits (210), Expect = 2e-17 Identities = 42/60 (70%), Positives = 49/60 (81%), Gaps = 2/60 (3%) Frame = +1 Query: 1 DRGSIHNLPRPP-AKVSWVLSGPGGFWSPFVDDSTVPECEKLKWSEAFVQSIH-EGIING 174 +R S+HNL PP AKVSWVLS PGGFW PF+DDS V E EKLKWSEAFV SI+ +G++NG Sbjct: 165 NRVSMHNLTEPPPAKVSWVLSCPGGFWCPFLDDSVVSESEKLKWSEAFVLSIYGDGVLNG 224 >XP_003597335.2 ribosomal protein L5 [Medicago truncatula] AES67586.2 ribosomal protein L5 [Medicago truncatula] Length = 230 Score = 84.7 bits (208), Expect = 4e-17 Identities = 36/47 (76%), Positives = 39/47 (82%) Frame = +1 Query: 1 DRGSIHNLPRPPAKVSWVLSGPGGFWSPFVDDSTVPECEKLKWSEAF 141 D GSIHNL +PP KVSWVLSGPGGFWSPF+DDS VP EK KW+E F Sbjct: 179 DGGSIHNLTKPPTKVSWVLSGPGGFWSPFLDDSIVPTSEKTKWNETF 225 >XP_013454611.1 methyl-CpG-binding domain protein [Medicago truncatula] KEH28642.1 methyl-CpG-binding domain protein [Medicago truncatula] Length = 250 Score = 85.1 bits (209), Expect = 4e-17 Identities = 41/63 (65%), Positives = 47/63 (74%), Gaps = 2/63 (3%) Frame = +1 Query: 1 DRGSIHNLPRPPAKVSWVLSGPGGFWSPFVDDSTVPECEKLKWSEAFVQSIH--EGIING 174 DRGSIHNL +PP KVSWVLS P GFW+PF+DD VP EK KWSEAF SI+ EG +G Sbjct: 188 DRGSIHNLTKPPTKVSWVLSSPEGFWNPFLDDYIVPASEKRKWSEAFSISINEFEGATSG 247 Query: 175 QWS 183 +S Sbjct: 248 VYS 250 >ABN06005.1 Methyl-CpG binding, putative [Medicago truncatula] Length = 251 Score = 84.7 bits (208), Expect = 6e-17 Identities = 36/47 (76%), Positives = 39/47 (82%) Frame = +1 Query: 1 DRGSIHNLPRPPAKVSWVLSGPGGFWSPFVDDSTVPECEKLKWSEAF 141 D GSIHNL +PP KVSWVLSGPGGFWSPF+DDS VP EK KW+E F Sbjct: 200 DGGSIHNLTKPPTKVSWVLSGPGGFWSPFLDDSIVPTSEKTKWNETF 246 >XP_019436228.1 PREDICTED: methyl-CpG-binding domain-containing protein 7-like isoform X2 [Lupinus angustifolius] Length = 244 Score = 82.0 bits (201), Expect = 6e-16 Identities = 36/52 (69%), Positives = 43/52 (82%) Frame = +1 Query: 1 DRGSIHNLPRPPAKVSWVLSGPGGFWSPFVDDSTVPECEKLKWSEAFVQSIH 156 +R +HNL +PPAKV WVLSG GG W+PF+DDS VP+ EKLKWSEAFV SI+ Sbjct: 192 NRPCMHNLSKPPAKVKWVLSGSGGCWNPFLDDSIVPDSEKLKWSEAFVLSIN 243 >XP_019436225.1 PREDICTED: methyl-CpG-binding domain-containing protein 7-like isoform X1 [Lupinus angustifolius] XP_019436226.1 PREDICTED: methyl-CpG-binding domain-containing protein 7-like isoform X1 [Lupinus angustifolius] XP_019436227.1 PREDICTED: methyl-CpG-binding domain-containing protein 7-like isoform X1 [Lupinus angustifolius] Length = 247 Score = 82.0 bits (201), Expect = 6e-16 Identities = 36/52 (69%), Positives = 43/52 (82%) Frame = +1 Query: 1 DRGSIHNLPRPPAKVSWVLSGPGGFWSPFVDDSTVPECEKLKWSEAFVQSIH 156 +R +HNL +PPAKV WVLSG GG W+PF+DDS VP+ EKLKWSEAFV SI+ Sbjct: 195 NRPCMHNLSKPPAKVKWVLSGSGGCWNPFLDDSIVPDSEKLKWSEAFVLSIN 246