BLASTX nr result
ID: Glycyrrhiza29_contig00037252
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza29_contig00037252 (374 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_003613416.2 matrix metalloproteinase [Medicago truncatula] AE... 62 6e-09 XP_004504503.1 PREDICTED: metalloendoproteinase 1 [Cicer arietinum] 60 6e-08 GAU26382.1 hypothetical protein TSUD_221090 [Trifolium subterran... 58 3e-07 >XP_003613416.2 matrix metalloproteinase [Medicago truncatula] AES96374.2 matrix metalloproteinase [Medicago truncatula] Length = 368 Score = 62.4 bits (150), Expect = 6e-09 Identities = 28/40 (70%), Positives = 33/40 (82%) Frame = -1 Query: 284 YAFDPAENLDDATKQVLANAFNSWAEVTTISFCETEPRTS 165 YAFDP+ENLDDATKQV ANAFN W++VTTI+F E +S Sbjct: 176 YAFDPSENLDDATKQVFANAFNQWSKVTTITFTEATSYSS 215 >XP_004504503.1 PREDICTED: metalloendoproteinase 1 [Cicer arietinum] Length = 374 Score = 59.7 bits (143), Expect = 6e-08 Identities = 26/35 (74%), Positives = 30/35 (85%) Frame = -1 Query: 284 YAFDPAENLDDATKQVLANAFNSWAEVTTISFCET 180 YAFDP ENLD+ TKQV ANAFN W++VTTI+F ET Sbjct: 182 YAFDPNENLDETTKQVFANAFNQWSKVTTITFSET 216 >GAU26382.1 hypothetical protein TSUD_221090 [Trifolium subterraneum] Length = 364 Score = 57.8 bits (138), Expect = 3e-07 Identities = 26/35 (74%), Positives = 29/35 (82%) Frame = -1 Query: 284 YAFDPAENLDDATKQVLANAFNSWAEVTTISFCET 180 YAFDP ENLDD+TKQV ANAF+ W+ VTTI F ET Sbjct: 174 YAFDPNENLDDSTKQVFANAFDKWSTVTTIQFNET 208