BLASTX nr result
ID: Glycyrrhiza29_contig00036741
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza29_contig00036741 (333 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KHN28469.1 hypothetical protein glysoja_035850, partial [Glycine... 54 2e-06 KRH57505.1 hypothetical protein GLYMA_05G065000 [Glycine max] 54 4e-06 GAU14026.1 hypothetical protein TSUD_168510 [Trifolium subterran... 53 5e-06 GAU26811.1 hypothetical protein TSUD_289160 [Trifolium subterran... 53 7e-06 GAU37184.1 hypothetical protein TSUD_30490 [Trifolium subterraneum] 52 1e-05 >KHN28469.1 hypothetical protein glysoja_035850, partial [Glycine soja] Length = 194 Score = 53.9 bits (128), Expect = 2e-06 Identities = 31/88 (35%), Positives = 46/88 (52%) Frame = +3 Query: 12 QNGESIPNPKHNQYMVLPRSTHREPAPIFHK*KQQPLLYYPLDFSSSRQSWMAL*AKYAN 191 Q+G S PNP++ + + + + Y ++R W+A+ A+YAN Sbjct: 51 QDGSSTPNPQYTNWFTIDQLIINLLLSAMTEANSLSFASY----DTARSLWVAIEAQYAN 106 Query: 192 PSCSHVMSLKTLLQRCHKGSESITEY*F 275 S SHVMS+K LQ C KG +SIT+Y F Sbjct: 107 TSRSHVMSIKNQLQCCTKGDKSITDYLF 134 >KRH57505.1 hypothetical protein GLYMA_05G065000 [Glycine max] Length = 307 Score = 53.9 bits (128), Expect = 4e-06 Identities = 31/88 (35%), Positives = 46/88 (52%) Frame = +3 Query: 12 QNGESIPNPKHNQYMVLPRSTHREPAPIFHK*KQQPLLYYPLDFSSSRQSWMAL*AKYAN 191 Q+G S PNP++ + + + + Y ++R W+A+ A+YAN Sbjct: 61 QDGSSTPNPQYTNWFTIDQLIINLLLSAMTEANNLSFASY----DTARSLWVAIEAQYAN 116 Query: 192 PSCSHVMSLKTLLQRCHKGSESITEY*F 275 S SHVMS+K LQ C KG +SIT+Y F Sbjct: 117 TSRSHVMSIKNQLQCCTKGDKSITDYLF 144 >GAU14026.1 hypothetical protein TSUD_168510 [Trifolium subterraneum] Length = 243 Score = 53.1 bits (126), Expect = 5e-06 Identities = 23/46 (50%), Positives = 35/46 (76%) Frame = +3 Query: 141 FSSSRQSWMAL*AKYANPSCSHVMSLKTLLQRCHKGSESITEY*FF 278 + ++R W+A+ A+YA+ S SHVMS+K +QRC KG +SIT+Y F+ Sbjct: 99 YDTTRTLWVAIEAQYASTSRSHVMSIKNQIQRCTKGEKSITDYLFY 144 >GAU26811.1 hypothetical protein TSUD_289160 [Trifolium subterraneum] Length = 359 Score = 53.1 bits (126), Expect = 7e-06 Identities = 23/46 (50%), Positives = 35/46 (76%) Frame = +3 Query: 141 FSSSRQSWMAL*AKYANPSCSHVMSLKTLLQRCHKGSESITEY*FF 278 + ++R W+A+ A+YA+ S SHVMS+K +QRC KG +SIT+Y F+ Sbjct: 99 YDTARTLWVAIEAQYASTSRSHVMSIKNQIQRCTKGEKSITDYLFY 144 >GAU37184.1 hypothetical protein TSUD_30490 [Trifolium subterraneum] Length = 238 Score = 52.4 bits (124), Expect = 1e-05 Identities = 23/43 (53%), Positives = 35/43 (81%) Frame = +3 Query: 147 SSRQSWMAL*AKYANPSCSHVMSLKTLLQRCHKGSESITEY*F 275 ++R+ W+A+ AKYA+PS +HVMSLK LQR KGS+++T++ F Sbjct: 61 TARKLWLAIQAKYADPSRAHVMSLKNQLQRSRKGSQTVTKFMF 103