BLASTX nr result
ID: Glycyrrhiza29_contig00036382
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza29_contig00036382 (332 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007142143.1 hypothetical protein PHAVU_008G256100g [Phaseolus... 55 8e-08 >XP_007142143.1 hypothetical protein PHAVU_008G256100g [Phaseolus vulgaris] ESW14137.1 hypothetical protein PHAVU_008G256100g [Phaseolus vulgaris] Length = 95 Score = 55.5 bits (132), Expect = 8e-08 Identities = 31/46 (67%), Positives = 31/46 (67%) Frame = -3 Query: 138 FQNDKVFFHNGRSITAAAILLQVNFFCLGNLPIYHQIWLELLLDIK 1 F K FHNGRSITAA I LQV F CLG L YHQI LELL IK Sbjct: 52 FNTTKASFHNGRSITAAVISLQVIFVCLGEL--YHQIRLELLSSIK 95