BLASTX nr result
ID: Glycyrrhiza29_contig00036114
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza29_contig00036114 (228 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KYP52499.1 Pentatricopeptide repeat-containing protein At4g21065... 92 3e-20 XP_004498663.1 PREDICTED: pentatricopeptide repeat-containing pr... 92 6e-20 KHN33926.1 Pentatricopeptide repeat-containing protein [Glycine ... 90 1e-19 XP_006601143.1 PREDICTED: pentatricopeptide repeat-containing pr... 90 2e-19 XP_003588753.1 PPR containing plant-like protein [Medicago trunc... 89 4e-19 XP_016162688.1 PREDICTED: pentatricopeptide repeat-containing pr... 88 1e-18 XP_015971970.1 PREDICTED: pentatricopeptide repeat-containing pr... 88 1e-18 BAT82320.1 hypothetical protein VIGAN_03232000 [Vigna angularis ... 86 5e-18 XP_014503863.1 PREDICTED: pentatricopeptide repeat-containing pr... 86 5e-18 XP_017408085.1 PREDICTED: pentatricopeptide repeat-containing pr... 86 5e-18 XP_019447541.1 PREDICTED: pentatricopeptide repeat-containing pr... 85 1e-17 XP_007161217.1 hypothetical protein PHAVU_001G0518001g, partial ... 84 1e-17 XP_002308660.2 hypothetical protein POPTR_0006s26860g [Populus t... 84 4e-17 XP_011039733.1 PREDICTED: pentatricopeptide repeat-containing pr... 84 4e-17 XP_008366695.1 PREDICTED: pentatricopeptide repeat-containing pr... 83 5e-17 KDO61702.1 hypothetical protein CISIN_1g038542mg, partial [Citru... 83 7e-17 XP_008387666.1 PREDICTED: pentatricopeptide repeat-containing pr... 83 8e-17 XP_006483346.1 PREDICTED: pentatricopeptide repeat-containing pr... 83 8e-17 XP_012076594.1 PREDICTED: pentatricopeptide repeat-containing pr... 83 8e-17 XP_006450458.1 hypothetical protein CICLE_v10010438mg, partial [... 83 8e-17 >KYP52499.1 Pentatricopeptide repeat-containing protein At4g21065 family [Cajanus cajan] Length = 611 Score = 92.4 bits (228), Expect = 3e-20 Identities = 42/47 (89%), Positives = 44/47 (93%) Frame = -2 Query: 143 EPDDVAFIGVLSACSHSGLVDKGRCYFNSMEGKFSIVPKIEHYGCMV 3 EPDDVAFIGVLSACSHSGLVDKGR YFN+ME +F IVPKIEHYGCMV Sbjct: 337 EPDDVAFIGVLSACSHSGLVDKGRYYFNTMENRFCIVPKIEHYGCMV 383 Score = 52.0 bits (123), Expect = 6e-06 Identities = 27/51 (52%), Positives = 33/51 (64%) Frame = -2 Query: 227 MLSRAGLVKEALEFVSKMPLEPNQIIWREPDDVAFIGVLSACSHSGLVDKG 75 MLSRAGLV EALEFV MP+EPNQ+IWR +++AC G + G Sbjct: 385 MLSRAGLVNEALEFVRAMPVEPNQVIWR--------SIVTACHARGELKLG 427 >XP_004498663.1 PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like [Cicer arietinum] Length = 609 Score = 91.7 bits (226), Expect = 6e-20 Identities = 43/46 (93%), Positives = 43/46 (93%) Frame = -2 Query: 140 PDDVAFIGVLSACSHSGLVDKGRCYFNSMEGKFSIVPKIEHYGCMV 3 PDDVAFIGVLSACSHSGLVDKGR YFNSME FSIVPKIEHYGCMV Sbjct: 336 PDDVAFIGVLSACSHSGLVDKGRHYFNSMERNFSIVPKIEHYGCMV 381 >KHN33926.1 Pentatricopeptide repeat-containing protein [Glycine soja] Length = 402 Score = 90.1 bits (222), Expect = 1e-19 Identities = 41/47 (87%), Positives = 43/47 (91%) Frame = -2 Query: 143 EPDDVAFIGVLSACSHSGLVDKGRCYFNSMEGKFSIVPKIEHYGCMV 3 +PDDVAFIGVLSACSHSGLVDKG YFN+ME FSIVPKIEHYGCMV Sbjct: 128 DPDDVAFIGVLSACSHSGLVDKGHYYFNTMENMFSIVPKIEHYGCMV 174 >XP_006601143.1 PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like [Glycine max] XP_006601144.1 PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like [Glycine max] KRH05148.1 hypothetical protein GLYMA_17G209700 [Glycine max] KRH05149.1 hypothetical protein GLYMA_17G209700 [Glycine max] Length = 615 Score = 90.1 bits (222), Expect = 2e-19 Identities = 41/47 (87%), Positives = 43/47 (91%) Frame = -2 Query: 143 EPDDVAFIGVLSACSHSGLVDKGRCYFNSMEGKFSIVPKIEHYGCMV 3 +PDDVAFIGVLSACSHSGLVDKG YFN+ME FSIVPKIEHYGCMV Sbjct: 341 DPDDVAFIGVLSACSHSGLVDKGHYYFNTMENMFSIVPKIEHYGCMV 387 >XP_003588753.1 PPR containing plant-like protein [Medicago truncatula] AES59004.1 PPR containing plant-like protein [Medicago truncatula] Length = 600 Score = 89.4 bits (220), Expect = 4e-19 Identities = 41/46 (89%), Positives = 42/46 (91%) Frame = -2 Query: 140 PDDVAFIGVLSACSHSGLVDKGRCYFNSMEGKFSIVPKIEHYGCMV 3 PDDVAFIGVLSACSHSGLVDKGR YF SME FSIVPK+EHYGCMV Sbjct: 327 PDDVAFIGVLSACSHSGLVDKGRYYFGSMERNFSIVPKVEHYGCMV 372 >XP_016162688.1 PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like [Arachis ipaensis] Length = 611 Score = 88.2 bits (217), Expect = 1e-18 Identities = 41/46 (89%), Positives = 42/46 (91%) Frame = -2 Query: 140 PDDVAFIGVLSACSHSGLVDKGRCYFNSMEGKFSIVPKIEHYGCMV 3 PDDVAFIGVLSACSHSGLV+KG YFNSME FSIVPKIEHYGCMV Sbjct: 338 PDDVAFIGVLSACSHSGLVNKGHYYFNSMEKNFSIVPKIEHYGCMV 383 Score = 54.3 bits (129), Expect = 8e-07 Identities = 27/46 (58%), Positives = 32/46 (69%) Frame = -2 Query: 227 MLSRAGLVKEALEFVSKMPLEPNQIIWREPDDVAFIGVLSACSHSG 90 +LSRAGLVKEALEFV KMP+ PNQIIWR +++AC G Sbjct: 385 LLSRAGLVKEALEFVQKMPINPNQIIWR--------SIITACHARG 422 >XP_015971970.1 PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like [Arachis duranensis] Length = 617 Score = 88.2 bits (217), Expect = 1e-18 Identities = 41/46 (89%), Positives = 42/46 (91%) Frame = -2 Query: 140 PDDVAFIGVLSACSHSGLVDKGRCYFNSMEGKFSIVPKIEHYGCMV 3 PDDVAFIGVLSACSHSGLV+KG YFNSME FSIVPKIEHYGCMV Sbjct: 344 PDDVAFIGVLSACSHSGLVNKGHYYFNSMEKNFSIVPKIEHYGCMV 389 Score = 54.3 bits (129), Expect = 8e-07 Identities = 27/46 (58%), Positives = 32/46 (69%) Frame = -2 Query: 227 MLSRAGLVKEALEFVSKMPLEPNQIIWREPDDVAFIGVLSACSHSG 90 +LSRAGLVKEALEFV KMP+ PNQIIWR +++AC G Sbjct: 391 LLSRAGLVKEALEFVQKMPINPNQIIWR--------SIITACHARG 428 >BAT82320.1 hypothetical protein VIGAN_03232000 [Vigna angularis var. angularis] Length = 616 Score = 86.3 bits (212), Expect = 5e-18 Identities = 38/47 (80%), Positives = 42/47 (89%) Frame = -2 Query: 143 EPDDVAFIGVLSACSHSGLVDKGRCYFNSMEGKFSIVPKIEHYGCMV 3 EPDDVAF+GVL ACSHSGLVDKG YF +ME +F+IVPKIEHYGCMV Sbjct: 342 EPDDVAFVGVLYACSHSGLVDKGHYYFKTMENRFNIVPKIEHYGCMV 388 Score = 53.5 bits (127), Expect = 2e-06 Identities = 26/46 (56%), Positives = 33/46 (71%) Frame = -2 Query: 227 MLSRAGLVKEALEFVSKMPLEPNQIIWREPDDVAFIGVLSACSHSG 90 MLSRAGLVKEA+EFV MP+EPNQ+IWR +++AC+ G Sbjct: 390 MLSRAGLVKEAVEFVGAMPVEPNQVIWR--------SIVTACNARG 427 >XP_014503863.1 PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like [Vigna radiata var. radiata] Length = 616 Score = 86.3 bits (212), Expect = 5e-18 Identities = 38/47 (80%), Positives = 42/47 (89%) Frame = -2 Query: 143 EPDDVAFIGVLSACSHSGLVDKGRCYFNSMEGKFSIVPKIEHYGCMV 3 EPDDVAF+GVL ACSHSGLVDKG YF +ME +F+IVPKIEHYGCMV Sbjct: 342 EPDDVAFVGVLYACSHSGLVDKGHYYFKTMENRFNIVPKIEHYGCMV 388 Score = 53.5 bits (127), Expect = 2e-06 Identities = 26/46 (56%), Positives = 33/46 (71%) Frame = -2 Query: 227 MLSRAGLVKEALEFVSKMPLEPNQIIWREPDDVAFIGVLSACSHSG 90 MLSRAGLVKEA+EFV MP+EPNQ+IWR +++AC+ G Sbjct: 390 MLSRAGLVKEAVEFVGAMPVEPNQVIWR--------SIVTACNARG 427 >XP_017408085.1 PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like [Vigna angularis] KOM27755.1 hypothetical protein LR48_Vigan462s000800 [Vigna angularis] Length = 616 Score = 86.3 bits (212), Expect = 5e-18 Identities = 38/47 (80%), Positives = 42/47 (89%) Frame = -2 Query: 143 EPDDVAFIGVLSACSHSGLVDKGRCYFNSMEGKFSIVPKIEHYGCMV 3 EPDDVAF+GVL ACSHSGLVDKG YF +ME +F+IVPKIEHYGCMV Sbjct: 342 EPDDVAFVGVLYACSHSGLVDKGHYYFKTMENRFNIVPKIEHYGCMV 388 Score = 53.5 bits (127), Expect = 2e-06 Identities = 26/46 (56%), Positives = 33/46 (71%) Frame = -2 Query: 227 MLSRAGLVKEALEFVSKMPLEPNQIIWREPDDVAFIGVLSACSHSG 90 MLSRAGLVKEA+EFV MP+EPNQ+IWR +++AC+ G Sbjct: 390 MLSRAGLVKEAVEFVGAMPVEPNQVIWR--------SIVTACNARG 427 >XP_019447541.1 PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like [Lupinus angustifolius] Length = 630 Score = 85.1 bits (209), Expect = 1e-17 Identities = 40/46 (86%), Positives = 40/46 (86%) Frame = -2 Query: 140 PDDVAFIGVLSACSHSGLVDKGRCYFNSMEGKFSIVPKIEHYGCMV 3 PDDVAFIGVLSACSHSGLVDKG YFNSME F IVPKIEH GCMV Sbjct: 357 PDDVAFIGVLSACSHSGLVDKGHYYFNSMEKNFGIVPKIEHCGCMV 402 Score = 53.5 bits (127), Expect = 2e-06 Identities = 27/51 (52%), Positives = 34/51 (66%) Frame = -2 Query: 227 MLSRAGLVKEALEFVSKMPLEPNQIIWREPDDVAFIGVLSACSHSGLVDKG 75 +LSRAGLVKEA+EFV MP+EPNQIIWR +++AC G + G Sbjct: 404 LLSRAGLVKEAVEFVQNMPIEPNQIIWR--------SIITACHARGELKLG 446 >XP_007161217.1 hypothetical protein PHAVU_001G0518001g, partial [Phaseolus vulgaris] ESW33211.1 hypothetical protein PHAVU_001G0518001g, partial [Phaseolus vulgaris] Length = 380 Score = 84.3 bits (207), Expect = 1e-17 Identities = 37/47 (78%), Positives = 42/47 (89%) Frame = -2 Query: 143 EPDDVAFIGVLSACSHSGLVDKGRCYFNSMEGKFSIVPKIEHYGCMV 3 EPD+VAF+GVL ACSHSGLVDKG YF +ME +F+IVPKIEHYGCMV Sbjct: 106 EPDNVAFVGVLFACSHSGLVDKGHYYFKTMENRFNIVPKIEHYGCMV 152 Score = 51.6 bits (122), Expect = 7e-06 Identities = 25/46 (54%), Positives = 32/46 (69%) Frame = -2 Query: 227 MLSRAGLVKEALEFVSKMPLEPNQIIWREPDDVAFIGVLSACSHSG 90 MLSRAGLV EA+EFV MP+EPNQ+IWR +++AC+ G Sbjct: 154 MLSRAGLVNEAVEFVRAMPIEPNQVIWR--------SIVTACNARG 191 >XP_002308660.2 hypothetical protein POPTR_0006s26860g [Populus trichocarpa] EEE92183.2 hypothetical protein POPTR_0006s26860g [Populus trichocarpa] Length = 487 Score = 83.6 bits (205), Expect = 4e-17 Identities = 38/46 (82%), Positives = 41/46 (89%) Frame = -2 Query: 140 PDDVAFIGVLSACSHSGLVDKGRCYFNSMEGKFSIVPKIEHYGCMV 3 PDDV FIG+LSACSHSGLVDKG+ YF+SM FSIVPKIEHYGCMV Sbjct: 214 PDDVVFIGLLSACSHSGLVDKGKGYFDSMRKDFSIVPKIEHYGCMV 259 >XP_011039733.1 PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like [Populus euphratica] Length = 630 Score = 83.6 bits (205), Expect = 4e-17 Identities = 38/46 (82%), Positives = 41/46 (89%) Frame = -2 Query: 140 PDDVAFIGVLSACSHSGLVDKGRCYFNSMEGKFSIVPKIEHYGCMV 3 PDDV FIG+LSACSHSGLVDKG+ YF+SM FSIVPKIEHYGCMV Sbjct: 357 PDDVVFIGLLSACSHSGLVDKGKRYFDSMRKDFSIVPKIEHYGCMV 402 >XP_008366695.1 PREDICTED: pentatricopeptide repeat-containing protein At1g08070, chloroplastic-like, partial [Malus domestica] Length = 366 Score = 82.8 bits (203), Expect = 5e-17 Identities = 37/46 (80%), Positives = 42/46 (91%) Frame = -2 Query: 140 PDDVAFIGVLSACSHSGLVDKGRCYFNSMEGKFSIVPKIEHYGCMV 3 PDDVAF+G+LSACSHSGLV+KG+ YF+SM KF IVPKIEHYGCMV Sbjct: 93 PDDVAFLGLLSACSHSGLVEKGKRYFSSMVEKFQIVPKIEHYGCMV 138 >KDO61702.1 hypothetical protein CISIN_1g038542mg, partial [Citrus sinensis] Length = 475 Score = 82.8 bits (203), Expect = 7e-17 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = -2 Query: 140 PDDVAFIGVLSACSHSGLVDKGRCYFNSMEGKFSIVPKIEHYGCMV 3 PDDVAF+G+LSACSH GLVDKGR YF+SM+ F I+PKIEHYGCMV Sbjct: 211 PDDVAFVGLLSACSHCGLVDKGREYFDSMKNDFGIIPKIEHYGCMV 256 >XP_008387666.1 PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like [Malus domestica] XP_017192008.1 PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like [Malus domestica] Length = 595 Score = 82.8 bits (203), Expect = 8e-17 Identities = 37/46 (80%), Positives = 42/46 (91%) Frame = -2 Query: 140 PDDVAFIGVLSACSHSGLVDKGRCYFNSMEGKFSIVPKIEHYGCMV 3 PDDVAF+G+LSACSHSGLV+KG+ YF+SM KF IVPKIEHYGCMV Sbjct: 322 PDDVAFLGLLSACSHSGLVEKGKRYFSSMVEKFQIVPKIEHYGCMV 367 >XP_006483346.1 PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like isoform X1 [Citrus sinensis] Length = 600 Score = 82.8 bits (203), Expect = 8e-17 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = -2 Query: 140 PDDVAFIGVLSACSHSGLVDKGRCYFNSMEGKFSIVPKIEHYGCMV 3 PDDVAF+G+LSACSH GLVDKGR YF+SM+ F I+PKIEHYGCMV Sbjct: 327 PDDVAFVGLLSACSHCGLVDKGREYFDSMKNDFGIIPKIEHYGCMV 372 >XP_012076594.1 PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like [Jatropha curcas] KDP33607.1 hypothetical protein JCGZ_07178 [Jatropha curcas] Length = 612 Score = 82.8 bits (203), Expect = 8e-17 Identities = 36/46 (78%), Positives = 42/46 (91%) Frame = -2 Query: 140 PDDVAFIGVLSACSHSGLVDKGRCYFNSMEGKFSIVPKIEHYGCMV 3 PDDV+FIG+LSACSHSGLVDKGR YF++M+ F I+PKIEHYGCMV Sbjct: 339 PDDVSFIGLLSACSHSGLVDKGRDYFDNMKTNFGIIPKIEHYGCMV 384 >XP_006450458.1 hypothetical protein CICLE_v10010438mg, partial [Citrus clementina] ESR63698.1 hypothetical protein CICLE_v10010438mg, partial [Citrus clementina] Length = 629 Score = 82.8 bits (203), Expect = 8e-17 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = -2 Query: 140 PDDVAFIGVLSACSHSGLVDKGRCYFNSMEGKFSIVPKIEHYGCMV 3 PDDVAF+G+LSACSH GLVDKGR YF+SM+ F I+PKIEHYGCMV Sbjct: 356 PDDVAFVGLLSACSHCGLVDKGREYFDSMKNDFGIIPKIEHYGCMV 401