BLASTX nr result
ID: Glycyrrhiza29_contig00035408
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza29_contig00035408 (213 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KRH11341.1 hypothetical protein GLYMA_15G101700 [Glycine max] 85 1e-17 NP_001304395.1 F-box/kelch-repeat protein At3g23880-like [Glycin... 85 1e-17 XP_013464670.1 F-box protein interaction domain protein [Medicag... 79 1e-15 GAU20087.1 hypothetical protein TSUD_381790 [Trifolium subterran... 77 7e-15 XP_013464668.1 F-box protein interaction domain protein [Medicag... 76 1e-14 XP_013441431.1 F-box protein interaction domain protein [Medicag... 75 2e-14 XP_013441569.1 F-box protein interaction domain protein [Medicag... 75 2e-14 XP_013443080.1 F-box protein interaction domain protein [Medicag... 75 3e-14 XP_003594508.2 F-box protein interaction domain protein [Medicag... 75 4e-14 GAU30118.1 hypothetical protein TSUD_360110 [Trifolium subterran... 73 1e-13 GAU24895.1 hypothetical protein TSUD_116190 [Trifolium subterran... 73 2e-13 XP_004486107.1 PREDICTED: F-box/kelch-repeat protein At3g23880-l... 73 2e-13 XP_003599217.1 F-box protein interaction domain protein [Medicag... 72 2e-13 XP_019426099.1 PREDICTED: F-box/kelch-repeat protein At3g23880-l... 72 2e-13 XP_003594087.1 F-box protein interaction domain protein [Medicag... 72 3e-13 XP_013458776.1 F-box protein interaction domain protein [Medicag... 72 4e-13 XP_019420066.1 PREDICTED: F-box/kelch-repeat protein At3g23880-l... 72 5e-13 XP_003599216.1 F-box protein interaction domain protein [Medicag... 72 5e-13 GAU38064.1 hypothetical protein TSUD_318580 [Trifolium subterran... 71 9e-13 GAU50212.1 hypothetical protein TSUD_408950 [Trifolium subterran... 70 2e-12 >KRH11341.1 hypothetical protein GLYMA_15G101700 [Glycine max] Length = 393 Score = 84.7 bits (208), Expect = 1e-17 Identities = 47/71 (66%), Positives = 52/71 (73%) Frame = -1 Query: 213 YKVVAVFCLDQYVRDKTQVCIYTLGTDSWRTIQEFPYGSPTCEPGIFVSGTVNWLAFAAS 34 YKVVA+FC + R +TQV + TLGTDSWR IQEFP G P E G FVSGTVNWLA S Sbjct: 198 YKVVAIFCYECDGRYETQVKVLTLGTDSWRRIQEFPSGLPFDESGKFVSGTVNWLASNDS 257 Query: 33 SSWPVIVSLDL 1 SS +IVSLDL Sbjct: 258 SSL-IIVSLDL 267 >NP_001304395.1 F-box/kelch-repeat protein At3g23880-like [Glycine max] ACU22680.1 unknown [Glycine max] Length = 393 Score = 84.7 bits (208), Expect = 1e-17 Identities = 47/71 (66%), Positives = 52/71 (73%) Frame = -1 Query: 213 YKVVAVFCLDQYVRDKTQVCIYTLGTDSWRTIQEFPYGSPTCEPGIFVSGTVNWLAFAAS 34 YKVVA+FC + R +TQV + TLGTDSWR IQEFP G P E G FVSGTVNWLA S Sbjct: 198 YKVVAIFCYECDGRYETQVKVLTLGTDSWRRIQEFPSGLPFDESGKFVSGTVNWLASNDS 257 Query: 33 SSWPVIVSLDL 1 SS +IVSLDL Sbjct: 258 SSL-IIVSLDL 267 >XP_013464670.1 F-box protein interaction domain protein [Medicago truncatula] KEH38705.1 F-box protein interaction domain protein [Medicago truncatula] Length = 358 Score = 78.6 bits (192), Expect = 1e-15 Identities = 39/71 (54%), Positives = 48/71 (67%) Frame = -1 Query: 213 YKVVAVFCLDQYVRDKTQVCIYTLGTDSWRTIQEFPYGSPTCEPGIFVSGTVNWLAFAAS 34 YK+VA+ V D+ +V ++TLGTD+WR I +FPY P C GIFV GTVNWL+ Sbjct: 186 YKIVAI----SLVEDREEVSVHTLGTDTWRRIPDFPYSGPFCGYGIFVGGTVNWLSLDEV 241 Query: 33 SSWPVIVSLDL 1 SS VIVSLDL Sbjct: 242 SSLCVIVSLDL 252 >GAU20087.1 hypothetical protein TSUD_381790 [Trifolium subterraneum] Length = 436 Score = 77.0 bits (188), Expect = 7e-15 Identities = 44/76 (57%), Positives = 48/76 (63%), Gaps = 5/76 (6%) Frame = -1 Query: 213 YKVVAVFCLDQYVRD-----KTQVCIYTLGTDSWRTIQEFPYGSPTCEPGIFVSGTVNWL 49 YKVVAV D Y D KT+V +YTLGT SWR IQ+FPYG P G FVSGTVNW Sbjct: 224 YKVVAVNHYDAYRSDNDVISKTRVKVYTLGTSSWRMIQDFPYGIPLHPCGTFVSGTVNWW 283 Query: 48 AFAASSSWPVIVSLDL 1 S + VIVSLDL Sbjct: 284 VTNGSHTSRVIVSLDL 299 >XP_013464668.1 F-box protein interaction domain protein [Medicago truncatula] KEH38703.1 F-box protein interaction domain protein [Medicago truncatula] Length = 310 Score = 75.9 bits (185), Expect = 1e-14 Identities = 39/71 (54%), Positives = 49/71 (69%) Frame = -1 Query: 213 YKVVAVFCLDQYVRDKTQVCIYTLGTDSWRTIQEFPYGSPTCEPGIFVSGTVNWLAFAAS 34 YK+VAV V D+ +V ++TLGTD+WR I +FPY P GIF+SGTVNW++F Sbjct: 111 YKIVAV----SLVEDREEVSVHTLGTDTWRRIPDFPYNGPFDRFGIFLSGTVNWMSFDNV 166 Query: 33 SSWPVIVSLDL 1 SS VIVSLDL Sbjct: 167 SSSCVIVSLDL 177 >XP_013441431.1 F-box protein interaction domain protein [Medicago truncatula] KEH15456.1 F-box protein interaction domain protein [Medicago truncatula] Length = 362 Score = 75.5 bits (184), Expect = 2e-14 Identities = 39/71 (54%), Positives = 48/71 (67%) Frame = -1 Query: 213 YKVVAVFCLDQYVRDKTQVCIYTLGTDSWRTIQEFPYGSPTCEPGIFVSGTVNWLAFAAS 34 YK+VA+ +DKT+V ++TLGT SW I +FPY SP C GIFV+G VNWLA Sbjct: 168 YKIVAL----SLCKDKTEVSVHTLGTYSWIKIHDFPYTSPLCGSGIFVNGNVNWLALDGV 223 Query: 33 SSWPVIVSLDL 1 +S VIVSLDL Sbjct: 224 TSSCVIVSLDL 234 >XP_013441569.1 F-box protein interaction domain protein [Medicago truncatula] KEH15594.1 F-box protein interaction domain protein [Medicago truncatula] Length = 392 Score = 75.5 bits (184), Expect = 2e-14 Identities = 39/71 (54%), Positives = 48/71 (67%) Frame = -1 Query: 213 YKVVAVFCLDQYVRDKTQVCIYTLGTDSWRTIQEFPYGSPTCEPGIFVSGTVNWLAFAAS 34 YK+VA+ +DKT+V ++TLGT SW I +FPY SP C GIFV+G VNWLA Sbjct: 198 YKIVAL----SLCKDKTEVSVHTLGTYSWIKIHDFPYTSPLCGSGIFVNGNVNWLALDGV 253 Query: 33 SSWPVIVSLDL 1 +S VIVSLDL Sbjct: 254 TSSCVIVSLDL 264 >XP_013443080.1 F-box protein interaction domain protein [Medicago truncatula] KEH17105.1 F-box protein interaction domain protein [Medicago truncatula] Length = 392 Score = 75.1 bits (183), Expect = 3e-14 Identities = 41/75 (54%), Positives = 52/75 (69%), Gaps = 4/75 (5%) Frame = -1 Query: 213 YKVVAVF-CLDQYVRDKTQVCIYTLGTDSWRTIQEFPYGSPTCEPGIFVSGTVNWLAF-- 43 YK++ V C++ K++VCI TLGTD WR I++FPY P E GIFVSGTVNWLA Sbjct: 193 YKIIVVSSCIN-----KSEVCILTLGTDYWRRIKDFPYDGPLHESGIFVSGTVNWLAIDN 247 Query: 42 -AASSSWPVIVSLDL 1 +++SS IVSLDL Sbjct: 248 SSSNSSLRAIVSLDL 262 >XP_003594508.2 F-box protein interaction domain protein [Medicago truncatula] AES64759.2 F-box protein interaction domain protein [Medicago truncatula] Length = 405 Score = 74.7 bits (182), Expect = 4e-14 Identities = 42/73 (57%), Positives = 51/73 (69%), Gaps = 2/73 (2%) Frame = -1 Query: 213 YKVVAVFCLDQYVRD-KTQVCIYTLGTDSWRTIQEFPYGSPTCEPGIFVSGTVNWLAFAA 37 YKVVAV+C + D KTQV ++TLGT+ WR I + P+G P E G FVSGTVNWLA Sbjct: 204 YKVVAVYCFESDNGDYKTQVKVHTLGTNFWRRIHDLPFGVPFDESGKFVSGTVNWLASND 263 Query: 36 SS-SWPVIVSLDL 1 SS + +IVSLDL Sbjct: 264 SSYTSSIIVSLDL 276 >GAU30118.1 hypothetical protein TSUD_360110 [Trifolium subterraneum] Length = 304 Score = 72.8 bits (177), Expect = 1e-13 Identities = 39/73 (53%), Positives = 50/73 (68%), Gaps = 2/73 (2%) Frame = -1 Query: 213 YKVVAVFCLDQYVRDK-TQVCIYTLGTDSWRTIQEFPYGSPTCEPGIFVSGTVNWLAF-A 40 YKV+A+ + +DK +V ++ LGT SWR IQ+FPY P +PG+FVSGTVNW+AF Sbjct: 196 YKVIAI----SFSKDKGNEVNVHALGTGSWRRIQDFPYPHPVVKPGVFVSGTVNWIAFDD 251 Query: 39 ASSSWPVIVSLDL 1 S VIVSLDL Sbjct: 252 VSYKSSVIVSLDL 264 >GAU24895.1 hypothetical protein TSUD_116190 [Trifolium subterraneum] Length = 367 Score = 72.8 bits (177), Expect = 2e-13 Identities = 42/77 (54%), Positives = 51/77 (66%), Gaps = 6/77 (7%) Frame = -1 Query: 213 YKVVAVFCLDQYVRDKTQVCIYTLGTDSWRTIQEFPYGS-PTCEPGIFVSGTVNWLAFAA 37 YKVVA+FC D KT+V ++T+GT+ WR IQEFP+GS P E G FV+GTVNWLA Sbjct: 159 YKVVAIFCYDN---GKTKVNVHTMGTNCWRKIQEFPFGSVPVGESGKFVNGTVNWLASGN 215 Query: 36 SS-----SWPVIVSLDL 1 + S IVSLDL Sbjct: 216 ENGIRLISSSSIVSLDL 232 >XP_004486107.1 PREDICTED: F-box/kelch-repeat protein At3g23880-like [Cicer arietinum] Length = 405 Score = 72.8 bits (177), Expect = 2e-13 Identities = 44/79 (55%), Positives = 51/79 (64%), Gaps = 8/79 (10%) Frame = -1 Query: 213 YKVVAVFCLDQYVRD-------KTQVCIYTLGTDSWRTIQEFPYGSPTCEPGIFVSGTVN 55 YKVVAV C + KT+V ++TLGT+SWR IQ+FP G P E G FV+GTVN Sbjct: 199 YKVVAVSCYESDTNGSTSNRVYKTEVKVHTLGTNSWRRIQDFPSGVPFDESGKFVNGTVN 258 Query: 54 WLAFAA-SSSWPVIVSLDL 1 WLA SSW VIVSLDL Sbjct: 259 WLASTDWISSW-VIVSLDL 276 >XP_003599217.1 F-box protein interaction domain protein [Medicago truncatula] AES69468.1 F-box protein interaction domain protein [Medicago truncatula] Length = 301 Score = 72.0 bits (175), Expect = 2e-13 Identities = 36/72 (50%), Positives = 51/72 (70%), Gaps = 1/72 (1%) Frame = -1 Query: 213 YKVVAVFCLDQYVRDKTQVCIYTLGTDSWRTIQEFPYGSPTCEPGIFVSGTVNWLAFAAS 34 YK+VAV + +++ +V +YTLGT++WR IQ+FPY + PG+FVSGT+NWL++ S Sbjct: 101 YKIVAV----SFFKNQYRVSVYTLGTNTWRRIQDFPYSHISDNPGVFVSGTINWLSYDIS 156 Query: 33 SS-WPVIVSLDL 1 S IVSLDL Sbjct: 157 SRLLNAIVSLDL 168 >XP_019426099.1 PREDICTED: F-box/kelch-repeat protein At3g23880-like [Lupinus angustifolius] OIV91958.1 hypothetical protein TanjilG_23219 [Lupinus angustifolius] Length = 369 Score = 72.4 bits (176), Expect = 2e-13 Identities = 41/75 (54%), Positives = 52/75 (69%), Gaps = 4/75 (5%) Frame = -1 Query: 213 YKVVAVFCLDQYVRDKTQVCIYTLGTDSWRTIQEFPYG-SPTCEPGIFVSGTVNWLA--- 46 YKVVAVFC +++V +Y++GT+SWR IQ+FP+G SP G FVSGT+NW A Sbjct: 167 YKVVAVFCDPNEFFSESKVKVYSMGTNSWRKIQDFPHGVSPYQNSGKFVSGTLNWAANCS 226 Query: 45 FAASSSWPVIVSLDL 1 +SS W VIVSLDL Sbjct: 227 LCSSSLW-VIVSLDL 240 >XP_003594087.1 F-box protein interaction domain protein [Medicago truncatula] AES64338.1 F-box protein interaction domain protein [Medicago truncatula] Length = 375 Score = 72.4 bits (176), Expect = 3e-13 Identities = 40/77 (51%), Positives = 47/77 (61%), Gaps = 6/77 (7%) Frame = -1 Query: 213 YKVVAVFCLDQYVRD------KTQVCIYTLGTDSWRTIQEFPYGSPTCEPGIFVSGTVNW 52 YKVVAV C + KT+V +YTLGTD WR IQ+FP G P G FVSGT+NW Sbjct: 172 YKVVAVNCFESDTDSNGSKVYKTEVKVYTLGTDYWRRIQDFPSGVPFDNSGTFVSGTINW 231 Query: 51 LAFAASSSWPVIVSLDL 1 LA + +IVSLDL Sbjct: 232 LAAKDPYTSWIIVSLDL 248 >XP_013458776.1 F-box protein interaction domain protein [Medicago truncatula] KEH32808.1 F-box protein interaction domain protein [Medicago truncatula] Length = 399 Score = 72.0 bits (175), Expect = 4e-13 Identities = 40/72 (55%), Positives = 49/72 (68%), Gaps = 1/72 (1%) Frame = -1 Query: 213 YKVVAVFCLDQYVRDKT-QVCIYTLGTDSWRTIQEFPYGSPTCEPGIFVSGTVNWLAFAA 37 YK+VAV + DK+ +V +YTLGTDSWR IQ+ PY EPG+F GT+NWLA + Sbjct: 205 YKIVAV----SFFYDKSYEVLVYTLGTDSWRRIQDLPYYGYISEPGVFARGTINWLAHES 260 Query: 36 SSSWPVIVSLDL 1 SSS IVSLDL Sbjct: 261 SSSHN-IVSLDL 271 >XP_019420066.1 PREDICTED: F-box/kelch-repeat protein At3g23880-like [Lupinus angustifolius] OIV95875.1 hypothetical protein TanjilG_06851 [Lupinus angustifolius] Length = 367 Score = 71.6 bits (174), Expect = 5e-13 Identities = 42/78 (53%), Positives = 50/78 (64%), Gaps = 7/78 (8%) Frame = -1 Query: 213 YKVVAVFCLD----QYVRDKTQVCIYTLGTDSWRTIQEFPYGSPTCEPGIFVSGTVNWLA 46 YKVV VFC + + +T+V ++TLGTD WR IQEFP G P G FV G +NWLA Sbjct: 164 YKVVGVFCYECGSGGAIAYRTEVKVHTLGTDYWRRIQEFPSGVPFDSSGKFVCGAINWLA 223 Query: 45 F---AASSSWPVIVSLDL 1 A +SSW VIVSLDL Sbjct: 224 SGSDAFNSSW-VIVSLDL 240 >XP_003599216.1 F-box protein interaction domain protein [Medicago truncatula] AES69467.1 F-box protein interaction domain protein [Medicago truncatula] Length = 393 Score = 71.6 bits (174), Expect = 5e-13 Identities = 39/72 (54%), Positives = 48/72 (66%), Gaps = 1/72 (1%) Frame = -1 Query: 213 YKVVAVFCLDQYVRDKT-QVCIYTLGTDSWRTIQEFPYGSPTCEPGIFVSGTVNWLAFAA 37 YK+V V + DK+ +VC YTLGTD WR IQ+ PYGS T G+F GT+NWLA+ + Sbjct: 187 YKIVGV----SFFPDKSNEVCCYTLGTDCWRRIQDLPYGS-TSAVGVFARGTINWLAYDS 241 Query: 36 SSSWPVIVSLDL 1 SS IVSLDL Sbjct: 242 QSSSHNIVSLDL 253 >GAU38064.1 hypothetical protein TSUD_318580 [Trifolium subterraneum] Length = 383 Score = 70.9 bits (172), Expect = 9e-13 Identities = 42/77 (54%), Positives = 52/77 (67%), Gaps = 6/77 (7%) Frame = -1 Query: 213 YKVVAVFCLDQYVRDKT-QVCIYTLGTDSWRTIQEFPYGSPTC---EPGIFVSGTVNWLA 46 YKV+A+ C +DK +V +YTLGT+ WR+IQ+FPY TC PG+FV GTVNWLA Sbjct: 183 YKVIAISCF----KDKNNEVDVYTLGTNYWRSIQDFPYS--TCNMYHPGVFVGGTVNWLA 236 Query: 45 FAAS--SSWPVIVSLDL 1 + S S VIVSLDL Sbjct: 237 YHVSNGSFCRVIVSLDL 253 >GAU50212.1 hypothetical protein TSUD_408950 [Trifolium subterraneum] Length = 402 Score = 70.1 bits (170), Expect = 2e-12 Identities = 38/71 (53%), Positives = 48/71 (67%) Frame = -1 Query: 213 YKVVAVFCLDQYVRDKTQVCIYTLGTDSWRTIQEFPYGSPTCEPGIFVSGTVNWLAFAAS 34 YKVVA+ ++ +V ++T GTDSWR IQ+FP+ C G+FVSGTVNWLA + S Sbjct: 200 YKVVAI---SFFMDGCNEVNVHTFGTDSWRRIQDFPFPHLVCAHGVFVSGTVNWLAHSIS 256 Query: 33 SSWPVIVSLDL 1 SS IVSLDL Sbjct: 257 SS-RAIVSLDL 266