BLASTX nr result
ID: Glycyrrhiza29_contig00035335
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza29_contig00035335 (258 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KRH23876.1 hypothetical protein GLYMA_12G008200 [Glycine max] 57 2e-07 >KRH23876.1 hypothetical protein GLYMA_12G008200 [Glycine max] Length = 1036 Score = 56.6 bits (135), Expect = 2e-07 Identities = 29/52 (55%), Positives = 37/52 (71%) Frame = +1 Query: 64 TNITLARVVRSSDPLNKISGSSLVDGKNMIGRGEPTKGGQPGSPAEISHRKT 219 TN +L VV S P +K S SSLVD KNMIGR +PTKGGQ P +I+H+++ Sbjct: 9 TNKSLVTVVLGSLPSSKFSDSSLVDEKNMIGREDPTKGGQLDFPVKINHQQS 60