BLASTX nr result
ID: Glycyrrhiza29_contig00034248
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza29_contig00034248 (276 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007150343.1 hypothetical protein PHAVU_005G145600g [Phaseolus... 56 1e-08 KOM44307.1 hypothetical protein LR48_Vigan05g191200 [Vigna angul... 53 2e-07 KRH10234.1 hypothetical protein GLYMA_15G036500, partial [Glycin... 52 6e-07 XP_009409022.1 PREDICTED: uncharacterized protein LOC103991334 [... 49 1e-05 >XP_007150343.1 hypothetical protein PHAVU_005G145600g [Phaseolus vulgaris] ESW22337.1 hypothetical protein PHAVU_005G145600g [Phaseolus vulgaris] Length = 70 Score = 56.2 bits (134), Expect = 1e-08 Identities = 23/32 (71%), Positives = 28/32 (87%) Frame = +1 Query: 1 FGKKREAPKNGYFHPPDLEELFSVLPPTPNYN 96 FG KREAPKNGYFHPPDL++LFS++ PT +N Sbjct: 39 FGMKREAPKNGYFHPPDLDQLFSLVLPTTAFN 70 >KOM44307.1 hypothetical protein LR48_Vigan05g191200 [Vigna angularis] BAT91848.1 hypothetical protein VIGAN_07048500 [Vigna angularis var. angularis] Length = 77 Score = 53.1 bits (126), Expect = 2e-07 Identities = 21/28 (75%), Positives = 25/28 (89%) Frame = +1 Query: 1 FGKKREAPKNGYFHPPDLEELFSVLPPT 84 FGKKR PKNGYFHPPDL++LFS++ PT Sbjct: 45 FGKKRAPPKNGYFHPPDLDQLFSIMLPT 72 >KRH10234.1 hypothetical protein GLYMA_15G036500, partial [Glycine max] Length = 71 Score = 52.0 bits (123), Expect = 6e-07 Identities = 19/29 (65%), Positives = 26/29 (89%) Frame = +1 Query: 1 FGKKREAPKNGYFHPPDLEELFSVLPPTP 87 FG+KR+ P NGYFHPPDL++LFS++ P+P Sbjct: 36 FGRKRDPPMNGYFHPPDLDQLFSLITPSP 64 >XP_009409022.1 PREDICTED: uncharacterized protein LOC103991334 [Musa acuminata subsp. malaccensis] Length = 88 Score = 49.3 bits (116), Expect = 1e-05 Identities = 19/26 (73%), Positives = 23/26 (88%) Frame = +1 Query: 1 FGKKREAPKNGYFHPPDLEELFSVLP 78 FGK+R+ PKNGYFHPPDLE LF++ P Sbjct: 57 FGKRRDPPKNGYFHPPDLEALFALAP 82