BLASTX nr result
ID: Glycyrrhiza29_contig00034061
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza29_contig00034061 (256 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU29126.1 hypothetical protein TSUD_58920 [Trifolium subterraneum] 52 9e-07 GAU51393.1 hypothetical protein TSUD_138060 [Trifolium subterran... 52 2e-06 GAU13938.1 hypothetical protein TSUD_262650 [Trifolium subterran... 52 6e-06 >GAU29126.1 hypothetical protein TSUD_58920 [Trifolium subterraneum] Length = 118 Score = 52.4 bits (124), Expect = 9e-07 Identities = 27/64 (42%), Positives = 42/64 (65%) Frame = -1 Query: 253 RIRELLSKLSDYCVLHVFREGNRCADVLANEGCGNLSSHLVIFEQAPVCVGYATRQDMMG 74 +I+ELL+ + + H++RE NRCAD+LAN G NL+++ +I+E+ P+ V D G Sbjct: 51 KIQELLNLDWEIRLTHIYREANRCADILANMG-SNLAANKMIYEEPPLEVRQVLFDDFRG 109 Query: 73 VSTP 62 VS P Sbjct: 110 VSLP 113 >GAU51393.1 hypothetical protein TSUD_138060 [Trifolium subterraneum] Length = 167 Score = 52.4 bits (124), Expect = 2e-06 Identities = 27/64 (42%), Positives = 42/64 (65%) Frame = -1 Query: 253 RIRELLSKLSDYCVLHVFREGNRCADVLANEGCGNLSSHLVIFEQAPVCVGYATRQDMMG 74 +I+ELL+ + + H++RE NRCAD+LAN G NL+++ +I+E+ P+ V D G Sbjct: 100 KIQELLNLDWEIRLTHIYREANRCADILANMG-SNLAANKMIYEEPPLEVRQVLFDDFRG 158 Query: 73 VSTP 62 VS P Sbjct: 159 VSLP 162 >GAU13938.1 hypothetical protein TSUD_262650 [Trifolium subterraneum] Length = 875 Score = 52.4 bits (124), Expect = 6e-06 Identities = 26/69 (37%), Positives = 40/69 (57%) Frame = -1 Query: 256 IRIRELLSKLSDYCVLHVFREGNRCADVLANEGCGNLSSHLVIFEQAPVCVGYATRQDMM 77 + IR+LL + + H +RE N+CAD LAN GC L ++ FE P + D+M Sbjct: 807 LNIRKLLDLDWEVTITHAYRETNKCADALANIGC-QLGREIIFFEDCPPHMKDLVLADVM 865 Query: 76 GVSTPCLMS 50 G++TP ++S Sbjct: 866 GITTPRMIS 874