BLASTX nr result
ID: Glycyrrhiza29_contig00033605
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza29_contig00033605 (255 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_004489985.1 PREDICTED: probable polygalacturonase At3g15720 [... 115 2e-30 >XP_004489985.1 PREDICTED: probable polygalacturonase At3g15720 [Cicer arietinum] Length = 206 Score = 115 bits (288), Expect = 2e-30 Identities = 54/62 (87%), Positives = 56/62 (90%) Frame = +2 Query: 32 MIKTILSPFDHYPLQL*LGEDFLPCQNPNLKLKQNHSRPQHPNHSYLNLHPPHLNQSTEV 211 MIKTILSPFDHYPLQL LGEDFLP NPNLKLKQN++ PQHPNHSYLNLH PHLNQ TEV Sbjct: 1 MIKTILSPFDHYPLQLELGEDFLPNLNPNLKLKQNNACPQHPNHSYLNLHSPHLNQGTEV 60 Query: 212 RQ 217 RQ Sbjct: 61 RQ 62