BLASTX nr result
ID: Glycyrrhiza29_contig00032924
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza29_contig00032924 (256 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value WP_006018723.1 MULTISPECIES: hypothetical protein [Afipia] EKS40... 114 4e-31 SCB51090.1 hypothetical protein GA0061099_101514 [Bradyrhizobium... 97 1e-24 SFU94618.1 hypothetical protein SAMN05192541_1087 [Bradyrhizobiu... 96 2e-24 WP_049795319.1 hypothetical protein [Bradyrhizobium sp. BTAi1] 65 9e-11 ABQ33710.1 putative lytic transglycosylase [Bradyrhizobium sp. B... 65 1e-10 WP_051054937.1 MULTISPECIES: lytic murein transglycosylase [Brad... 62 1e-09 EKS40933.1 hypothetical protein HMPREF9695_00025 [Afipia broomea... 62 2e-09 APG09525.1 lytic murein transglycosylase [Bradyrhizobium japonicum] 55 3e-07 WP_060737554.1 lytic murein transglycosylase [Bradyrhizobium sp.... 55 3e-07 WP_071917229.1 lytic murein transglycosylase [Bradyrhizobium jap... 55 3e-07 APG09528.1 lytic murein transglycosylase [Bradyrhizobium japonicum] 55 4e-07 WP_071917230.1 lytic murein transglycosylase [Bradyrhizobium jap... 55 5e-07 WP_050385511.1 hypothetical protein [Bradyrhizobium pachyrhizi] 55 6e-07 WP_036031071.1 hypothetical protein [Bradyrhizobium yuanmingense] 55 6e-07 SCB52470.1 Transglycosylase SLT domain-containing protein [Brady... 55 8e-07 SFV19851.1 Transglycosylase SLT domain-containing protein [Brady... 54 1e-06 SFO92119.1 Soluble lytic murein transglycosylase [Bradyrhizobium... 54 1e-06 SFV19621.1 Transglycosylase SLT domain-containing protein [Brady... 52 2e-06 WP_057026507.1 hypothetical protein [Bradyrhizobium yuanmingense... 52 4e-06 WP_028352040.1 hypothetical protein [Bradyrhizobium elkanii] 52 6e-06 >WP_006018723.1 MULTISPECIES: hypothetical protein [Afipia] EKS40934.1 hypothetical protein HMPREF9695_00026 [Afipia broomeae ATCC 49717] Length = 130 Score = 114 bits (286), Expect = 4e-31 Identities = 55/56 (98%), Positives = 55/56 (98%) Frame = -1 Query: 169 MTRCAGSQADGVWAMPSARALLVASLLTEPPFGCLGPSGNDRYRKRLEAVGASRVG 2 MTRCAGSQADGVWAMPSARALLVASLLTEPPFGCLGPSGNDRYRKR EAVGASRVG Sbjct: 1 MTRCAGSQADGVWAMPSARALLVASLLTEPPFGCLGPSGNDRYRKRSEAVGASRVG 56 >SCB51090.1 hypothetical protein GA0061099_101514 [Bradyrhizobium yuanmingense] Length = 87 Score = 97.1 bits (240), Expect = 1e-24 Identities = 51/67 (76%), Positives = 52/67 (77%), Gaps = 11/67 (16%) Frame = -1 Query: 169 MTRCAGSQ-----------ADGVWAMPSARALLVASLLTEPPFGCLGPSGNDRYRKRLEA 23 MT+CAGSQ A GVWAMPSARALLVA LLTEPPFGCLGPSGNDRYRKR EA Sbjct: 1 MTKCAGSQILACFNEQVLRAVGVWAMPSARALLVALLLTEPPFGCLGPSGNDRYRKRAEA 60 Query: 22 VGASRVG 2 VGAS VG Sbjct: 61 VGASPVG 67 >SFU94618.1 hypothetical protein SAMN05192541_1087 [Bradyrhizobium arachidis] Length = 71 Score = 95.9 bits (237), Expect = 2e-24 Identities = 46/54 (85%), Positives = 48/54 (88%) Frame = -1 Query: 169 MTRCAGSQADGVWAMPSARALLVASLLTEPPFGCLGPSGNDRYRKRLEAVGASR 8 MT+CA SQADGV AMPSARALLVASLLTEPPFGCLGPSGNDRYRKR + VG R Sbjct: 1 MTKCASSQADGVCAMPSARALLVASLLTEPPFGCLGPSGNDRYRKRSQTVGGVR 54 >WP_049795319.1 hypothetical protein [Bradyrhizobium sp. BTAi1] Length = 275 Score = 65.5 bits (158), Expect = 9e-11 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = -1 Query: 130 AMPSARALLVASLLTEPPFGCLGPSGNDRYRKR 32 AMP ARALLVASLLTEPP+GCLGPSG+DRYRKR Sbjct: 207 AMPLARALLVASLLTEPPYGCLGPSGSDRYRKR 239 >ABQ33710.1 putative lytic transglycosylase [Bradyrhizobium sp. BTAi1] Length = 338 Score = 65.5 bits (158), Expect = 1e-10 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = -1 Query: 130 AMPSARALLVASLLTEPPFGCLGPSGNDRYRKR 32 AMP ARALLVASLLTEPP+GCLGPSG+DRYRKR Sbjct: 270 AMPLARALLVASLLTEPPYGCLGPSGSDRYRKR 302 >WP_051054937.1 MULTISPECIES: lytic murein transglycosylase [Bradyrhizobiaceae] KQW19584.1 lytic murein transglycosylase [Afipia sp. Root123D2] Length = 226 Score = 62.0 bits (149), Expect = 1e-09 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = -2 Query: 255 TAFSAPDVSPMVPRPIGMFVPRSDSGVSR 169 TAFSAPDVSPMVPRPIGMFVPRSDSGVSR Sbjct: 198 TAFSAPDVSPMVPRPIGMFVPRSDSGVSR 226 >EKS40933.1 hypothetical protein HMPREF9695_00025 [Afipia broomeae ATCC 49717] Length = 276 Score = 62.0 bits (149), Expect = 2e-09 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = -2 Query: 255 TAFSAPDVSPMVPRPIGMFVPRSDSGVSR 169 TAFSAPDVSPMVPRPIGMFVPRSDSGVSR Sbjct: 248 TAFSAPDVSPMVPRPIGMFVPRSDSGVSR 276 >APG09525.1 lytic murein transglycosylase [Bradyrhizobium japonicum] Length = 226 Score = 55.5 bits (132), Expect = 3e-07 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = -2 Query: 252 AFSAPDVSPMVPRPIGMFVPRSDSGVSR 169 A SAPDVSPM+PRPIGMFVPRSDSGVSR Sbjct: 199 ANSAPDVSPMLPRPIGMFVPRSDSGVSR 226 >WP_060737554.1 lytic murein transglycosylase [Bradyrhizobium sp. CCGE-LA001] AMA61125.1 lytic murein transglycosylase [Bradyrhizobium sp. CCGE-LA001] Length = 240 Score = 55.5 bits (132), Expect = 3e-07 Identities = 25/29 (86%), Positives = 28/29 (96%) Frame = -2 Query: 255 TAFSAPDVSPMVPRPIGMFVPRSDSGVSR 169 TA SAPDVSPMVPRPIG+FVPRSD+GVS+ Sbjct: 212 TAISAPDVSPMVPRPIGVFVPRSDAGVSQ 240 >WP_071917229.1 lytic murein transglycosylase [Bradyrhizobium japonicum] Length = 243 Score = 55.5 bits (132), Expect = 3e-07 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = -2 Query: 252 AFSAPDVSPMVPRPIGMFVPRSDSGVSR 169 A SAPDVSPM+PRPIGMFVPRSDSGVSR Sbjct: 216 ANSAPDVSPMLPRPIGMFVPRSDSGVSR 243 >APG09528.1 lytic murein transglycosylase [Bradyrhizobium japonicum] Length = 240 Score = 55.1 bits (131), Expect = 4e-07 Identities = 25/29 (86%), Positives = 27/29 (93%) Frame = -2 Query: 255 TAFSAPDVSPMVPRPIGMFVPRSDSGVSR 169 TA SAPDVSPMVPRPIG+FVPRSDSG S+ Sbjct: 212 TAISAPDVSPMVPRPIGVFVPRSDSGASQ 240 >WP_071917230.1 lytic murein transglycosylase [Bradyrhizobium japonicum] Length = 246 Score = 55.1 bits (131), Expect = 5e-07 Identities = 25/29 (86%), Positives = 27/29 (93%) Frame = -2 Query: 255 TAFSAPDVSPMVPRPIGMFVPRSDSGVSR 169 TA SAPDVSPMVPRPIG+FVPRSDSG S+ Sbjct: 218 TAISAPDVSPMVPRPIGVFVPRSDSGASQ 246 >WP_050385511.1 hypothetical protein [Bradyrhizobium pachyrhizi] Length = 226 Score = 54.7 bits (130), Expect = 6e-07 Identities = 24/29 (82%), Positives = 27/29 (93%) Frame = -2 Query: 255 TAFSAPDVSPMVPRPIGMFVPRSDSGVSR 169 TA SAPDVSPMVPRP+G+FVPRSDSG S+ Sbjct: 198 TAISAPDVSPMVPRPVGVFVPRSDSGASQ 226 >WP_036031071.1 hypothetical protein [Bradyrhizobium yuanmingense] Length = 237 Score = 54.7 bits (130), Expect = 6e-07 Identities = 24/29 (82%), Positives = 27/29 (93%) Frame = -2 Query: 255 TAFSAPDVSPMVPRPIGMFVPRSDSGVSR 169 TA SAPDVSPMVPRP+G+FVPRSDSG S+ Sbjct: 209 TAISAPDVSPMVPRPVGVFVPRSDSGASQ 237 >SCB52470.1 Transglycosylase SLT domain-containing protein [Bradyrhizobium yuanmingense] Length = 294 Score = 54.7 bits (130), Expect = 8e-07 Identities = 24/29 (82%), Positives = 27/29 (93%) Frame = -2 Query: 255 TAFSAPDVSPMVPRPIGMFVPRSDSGVSR 169 TA SAPDVSPMVPRP+G+FVPRSDSG S+ Sbjct: 266 TAISAPDVSPMVPRPVGVFVPRSDSGASQ 294 >SFV19851.1 Transglycosylase SLT domain-containing protein [Bradyrhizobium arachidis] Length = 276 Score = 53.9 bits (128), Expect = 1e-06 Identities = 23/29 (79%), Positives = 28/29 (96%) Frame = -2 Query: 255 TAFSAPDVSPMVPRPIGMFVPRSDSGVSR 169 TA SAPDVSPMVPRP+G+FVPRSD+G+S+ Sbjct: 248 TAISAPDVSPMVPRPVGVFVPRSDAGLSQ 276 >SFO92119.1 Soluble lytic murein transglycosylase [Bradyrhizobium sp. Ghvi] Length = 297 Score = 53.9 bits (128), Expect = 1e-06 Identities = 24/29 (82%), Positives = 27/29 (93%) Frame = -2 Query: 255 TAFSAPDVSPMVPRPIGMFVPRSDSGVSR 169 TA SAPDVSPMVPRPIG+FVPRSD+G S+ Sbjct: 269 TAISAPDVSPMVPRPIGVFVPRSDAGASQ 297 >SFV19621.1 Transglycosylase SLT domain-containing protein [Bradyrhizobium arachidis] Length = 155 Score = 52.4 bits (124), Expect = 2e-06 Identities = 25/29 (86%), Positives = 27/29 (93%) Frame = -2 Query: 255 TAFSAPDVSPMVPRPIGMFVPRSDSGVSR 169 TAFSA DVS MVPRPIG+FVPRSDSGVS+ Sbjct: 127 TAFSASDVSRMVPRPIGVFVPRSDSGVSQ 155 >WP_057026507.1 hypothetical protein [Bradyrhizobium yuanmingense] KRQ01925.1 hypothetical protein AOQ72_10350 [Bradyrhizobium yuanmingense] Length = 237 Score = 52.4 bits (124), Expect = 4e-06 Identities = 25/29 (86%), Positives = 26/29 (89%) Frame = -2 Query: 255 TAFSAPDVSPMVPRPIGMFVPRSDSGVSR 169 TA SAPDVS MVPRPIGMFVPRSDSG S+ Sbjct: 209 TAISAPDVSHMVPRPIGMFVPRSDSGESQ 237 >WP_028352040.1 hypothetical protein [Bradyrhizobium elkanii] Length = 240 Score = 52.0 bits (123), Expect = 6e-06 Identities = 24/29 (82%), Positives = 26/29 (89%) Frame = -2 Query: 255 TAFSAPDVSPMVPRPIGMFVPRSDSGVSR 169 TA SA DVSPMVPRPIG+FVPRSDSG S+ Sbjct: 212 TAISATDVSPMVPRPIGVFVPRSDSGASQ 240