BLASTX nr result
ID: Glycyrrhiza29_contig00032916
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza29_contig00032916 (306 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BAT95250.1 hypothetical protein VIGAN_08193500 [Vigna angularis ... 54 2e-06 XP_012093022.1 PREDICTED: transcription factor MYB24-like isofor... 52 2e-06 XP_014512332.1 PREDICTED: transcription factor MYB108-like isofo... 54 3e-06 XP_016177559.1 PREDICTED: transcription factor MYB108-like isofo... 54 3e-06 XP_015939425.1 PREDICTED: transcription factor MYB108-like isofo... 54 3e-06 AAL84762.1 typical P-type R2R3 Myb protein, partial [Sorghum bic... 52 4e-06 ABC54990.1 MYB-like protein, partial [Vitis vinifera] 51 4e-06 ABC54984.1 MYB-like protein, partial [Vitis vinifera] 51 4e-06 ABC54973.1 MYB-like protein, partial [Vitis vinifera] 51 4e-06 AFK29428.1 R2R3MYB transcription factor, partial [Lotus japonicus] 52 5e-06 AAL84765.1 typical P-type R2R3 Myb protein, partial [Sorghum bic... 52 5e-06 EAZ19253.1 hypothetical protein OsJ_34790 [Oryza sativa Japonica... 52 5e-06 JAT66171.1 Myb-related protein 305, partial [Anthurium amnicola] 52 5e-06 KVH89684.1 Homeodomain-like protein [Cynara cardunculus var. sco... 53 5e-06 ACB59076.2 Myb-like transcription factor EOBI, partial [Petunia ... 51 5e-06 ONK67606.1 uncharacterized protein A4U43_C05F1830 [Asparagus off... 52 5e-06 KHN14149.1 Transcription factor MYB21, partial [Glycine soja] 51 6e-06 CCU64180.1 ScMYB28 protein [Saccharum hybrid cultivar Co 86032] 52 6e-06 JAU09692.1 hypothetical protein GA_TR14699_c0_g1_i1_g.45604, par... 50 6e-06 KMZ65523.1 Transcription factor WER [Zostera marina] 53 6e-06 >BAT95250.1 hypothetical protein VIGAN_08193500 [Vigna angularis var. angularis] Length = 293 Score = 54.3 bits (129), Expect = 2e-06 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +1 Query: 238 FHRWSKIAQHLPGRTDNEIKNYW 306 F RWSKIAQHLPGRTDNEIKNYW Sbjct: 131 FRRWSKIAQHLPGRTDNEIKNYW 153 >XP_012093022.1 PREDICTED: transcription factor MYB24-like isoform X2 [Jatropha curcas] Length = 139 Score = 52.4 bits (124), Expect = 2e-06 Identities = 21/22 (95%), Positives = 22/22 (100%) Frame = +1 Query: 241 HRWSKIAQHLPGRTDNEIKNYW 306 +RWSKIAQHLPGRTDNEIKNYW Sbjct: 99 NRWSKIAQHLPGRTDNEIKNYW 120 >XP_014512332.1 PREDICTED: transcription factor MYB108-like isoform X1 [Vigna radiata var. radiata] Length = 257 Score = 53.5 bits (127), Expect = 3e-06 Identities = 25/45 (55%), Positives = 27/45 (60%) Frame = +1 Query: 172 YFVLQVGCRYIQYNEHTPMFSIFHRWSKIAQHLPGRTDNEIKNYW 306 +F VGC + RWSKIAQHLPGRTDNEIKNYW Sbjct: 108 FFCYVVGC-----------IMFYRRWSKIAQHLPGRTDNEIKNYW 141 >XP_016177559.1 PREDICTED: transcription factor MYB108-like isoform X2 [Arachis ipaensis] Length = 262 Score = 53.5 bits (127), Expect = 3e-06 Identities = 23/35 (65%), Positives = 25/35 (71%) Frame = +1 Query: 202 IQYNEHTPMFSIFHRWSKIAQHLPGRTDNEIKNYW 306 I E + + RWSKIAQHLPGRTDNEIKNYW Sbjct: 81 ITLQEQILILDLHFRWSKIAQHLPGRTDNEIKNYW 115 >XP_015939425.1 PREDICTED: transcription factor MYB108-like isoform X2 [Arachis duranensis] Length = 262 Score = 53.5 bits (127), Expect = 3e-06 Identities = 23/35 (65%), Positives = 25/35 (71%) Frame = +1 Query: 202 IQYNEHTPMFSIFHRWSKIAQHLPGRTDNEIKNYW 306 I E + + RWSKIAQHLPGRTDNEIKNYW Sbjct: 81 ITLQEQILILDLHFRWSKIAQHLPGRTDNEIKNYW 115 >AAL84762.1 typical P-type R2R3 Myb protein, partial [Sorghum bicolor] Length = 165 Score = 52.4 bits (124), Expect = 4e-06 Identities = 21/22 (95%), Positives = 22/22 (100%) Frame = +1 Query: 241 HRWSKIAQHLPGRTDNEIKNYW 306 +RWSKIAQHLPGRTDNEIKNYW Sbjct: 80 NRWSKIAQHLPGRTDNEIKNYW 101 >ABC54990.1 MYB-like protein, partial [Vitis vinifera] Length = 95 Score = 50.8 bits (120), Expect = 4e-06 Identities = 20/22 (90%), Positives = 22/22 (100%) Frame = +1 Query: 241 HRWSKIAQHLPGRTDNEIKNYW 306 +RWSKIA+HLPGRTDNEIKNYW Sbjct: 73 NRWSKIAKHLPGRTDNEIKNYW 94 >ABC54984.1 MYB-like protein, partial [Vitis vinifera] Length = 97 Score = 50.8 bits (120), Expect = 4e-06 Identities = 20/22 (90%), Positives = 22/22 (100%) Frame = +1 Query: 241 HRWSKIAQHLPGRTDNEIKNYW 306 +RWSKIA+HLPGRTDNEIKNYW Sbjct: 75 NRWSKIAKHLPGRTDNEIKNYW 96 >ABC54973.1 MYB-like protein, partial [Vitis vinifera] Length = 97 Score = 50.8 bits (120), Expect = 4e-06 Identities = 20/22 (90%), Positives = 22/22 (100%) Frame = +1 Query: 241 HRWSKIAQHLPGRTDNEIKNYW 306 +RWSKIA+HLPGRTDNEIKNYW Sbjct: 75 NRWSKIAKHLPGRTDNEIKNYW 96 >AFK29428.1 R2R3MYB transcription factor, partial [Lotus japonicus] Length = 183 Score = 52.4 bits (124), Expect = 5e-06 Identities = 21/22 (95%), Positives = 22/22 (100%) Frame = +1 Query: 241 HRWSKIAQHLPGRTDNEIKNYW 306 +RWSKIAQHLPGRTDNEIKNYW Sbjct: 33 NRWSKIAQHLPGRTDNEIKNYW 54 >AAL84765.1 typical P-type R2R3 Myb protein, partial [Sorghum bicolor] Length = 183 Score = 52.4 bits (124), Expect = 5e-06 Identities = 21/22 (95%), Positives = 22/22 (100%) Frame = +1 Query: 241 HRWSKIAQHLPGRTDNEIKNYW 306 +RWSKIAQHLPGRTDNEIKNYW Sbjct: 98 NRWSKIAQHLPGRTDNEIKNYW 119 >EAZ19253.1 hypothetical protein OsJ_34790 [Oryza sativa Japonica Group] Length = 184 Score = 52.4 bits (124), Expect = 5e-06 Identities = 21/22 (95%), Positives = 22/22 (100%) Frame = +1 Query: 241 HRWSKIAQHLPGRTDNEIKNYW 306 +RWSKIAQHLPGRTDNEIKNYW Sbjct: 104 NRWSKIAQHLPGRTDNEIKNYW 125 >JAT66171.1 Myb-related protein 305, partial [Anthurium amnicola] Length = 185 Score = 52.4 bits (124), Expect = 5e-06 Identities = 21/22 (95%), Positives = 22/22 (100%) Frame = +1 Query: 241 HRWSKIAQHLPGRTDNEIKNYW 306 +RWSKIAQHLPGRTDNEIKNYW Sbjct: 156 NRWSKIAQHLPGRTDNEIKNYW 177 >KVH89684.1 Homeodomain-like protein [Cynara cardunculus var. scolymus] Length = 285 Score = 53.1 bits (126), Expect = 5e-06 Identities = 25/33 (75%), Positives = 25/33 (75%) Frame = +1 Query: 208 YNEHTPMFSIFHRWSKIAQHLPGRTDNEIKNYW 306 Y TPM H WSKIAQHLPGRTDNEIKNYW Sbjct: 51 YFPATPM----HIWSKIAQHLPGRTDNEIKNYW 79 >ACB59076.2 Myb-like transcription factor EOBI, partial [Petunia x hybrida] Length = 105 Score = 50.8 bits (120), Expect = 5e-06 Identities = 20/22 (90%), Positives = 22/22 (100%) Frame = +1 Query: 241 HRWSKIAQHLPGRTDNEIKNYW 306 +RWSKIA+HLPGRTDNEIKNYW Sbjct: 77 NRWSKIAKHLPGRTDNEIKNYW 98 >ONK67606.1 uncharacterized protein A4U43_C05F1830 [Asparagus officinalis] Length = 198 Score = 52.4 bits (124), Expect = 5e-06 Identities = 21/22 (95%), Positives = 22/22 (100%) Frame = +1 Query: 241 HRWSKIAQHLPGRTDNEIKNYW 306 +RWSKIAQHLPGRTDNEIKNYW Sbjct: 83 NRWSKIAQHLPGRTDNEIKNYW 104 >KHN14149.1 Transcription factor MYB21, partial [Glycine soja] Length = 112 Score = 50.8 bits (120), Expect = 6e-06 Identities = 20/22 (90%), Positives = 22/22 (100%) Frame = +1 Query: 241 HRWSKIAQHLPGRTDNEIKNYW 306 +RWSKIA+HLPGRTDNEIKNYW Sbjct: 80 NRWSKIARHLPGRTDNEIKNYW 101 >CCU64180.1 ScMYB28 protein [Saccharum hybrid cultivar Co 86032] Length = 202 Score = 52.4 bits (124), Expect = 6e-06 Identities = 21/22 (95%), Positives = 22/22 (100%) Frame = +1 Query: 241 HRWSKIAQHLPGRTDNEIKNYW 306 +RWSKIAQHLPGRTDNEIKNYW Sbjct: 80 NRWSKIAQHLPGRTDNEIKNYW 101 >JAU09692.1 hypothetical protein GA_TR14699_c0_g1_i1_g.45604, partial [Noccaea caerulescens] Length = 82 Score = 50.1 bits (118), Expect = 6e-06 Identities = 20/22 (90%), Positives = 22/22 (100%) Frame = +1 Query: 241 HRWSKIAQHLPGRTDNEIKNYW 306 +RWSKIAQ+LPGRTDNEIKNYW Sbjct: 38 NRWSKIAQYLPGRTDNEIKNYW 59 >KMZ65523.1 Transcription factor WER [Zostera marina] Length = 253 Score = 52.8 bits (125), Expect = 6e-06 Identities = 25/46 (54%), Positives = 30/46 (65%) Frame = +1 Query: 169 LYFVLQVGCRYIQYNEHTPMFSIFHRWSKIAQHLPGRTDNEIKNYW 306 L +L++ CR+ +RWSKIAQHLPGRTDNEIKNYW Sbjct: 80 LLLILELHCRW------------GNRWSKIAQHLPGRTDNEIKNYW 113