BLASTX nr result
ID: Glycyrrhiza29_contig00032843
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza29_contig00032843 (340 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_013452951.1 hypothetical protein MTR_6g082710, partial [Medic... 62 5e-10 >XP_013452951.1 hypothetical protein MTR_6g082710, partial [Medicago truncatula] KEH26979.1 hypothetical protein MTR_6g082710, partial [Medicago truncatula] Length = 108 Score = 61.6 bits (148), Expect = 5e-10 Identities = 31/57 (54%), Positives = 36/57 (63%), Gaps = 1/57 (1%) Frame = +2 Query: 2 FTLFCFTRFFQLRRQSL-VTTTDLSYFLQNTSLKATFLFILIEPHRKFASIPLDPPK 169 F +FCFTRFF R +SL V TDL YF + L T LFIL+ PH+K A I DP K Sbjct: 42 FKIFCFTRFFHYRERSLLVAITDLQYFGRMLGLIVTLLFILVNPHKKLAPISFDPKK 98