BLASTX nr result
ID: Glycyrrhiza29_contig00032296
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza29_contig00032296 (313 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU19291.1 hypothetical protein TSUD_335770 [Trifolium subterran... 70 2e-13 XP_013459289.1 hypothetical protein MTR_3g435560 [Medicago trunc... 59 4e-09 >GAU19291.1 hypothetical protein TSUD_335770 [Trifolium subterraneum] Length = 161 Score = 70.1 bits (170), Expect(2) = 2e-13 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = -3 Query: 260 RAAQSLARSLRIGYTSGTLNTKPISKKKVNYTQLHL 153 RAAQSLA SLRIGYTSGTLNTKPISKKKVNYTQLHL Sbjct: 126 RAAQSLACSLRIGYTSGTLNTKPISKKKVNYTQLHL 161 Score = 32.3 bits (72), Expect(2) = 2e-13 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -1 Query: 313 RSCTQQENECANLR 272 RSCTQQENECAN R Sbjct: 113 RSCTQQENECANAR 126 >XP_013459289.1 hypothetical protein MTR_3g435560 [Medicago truncatula] KEH33320.1 hypothetical protein MTR_3g435560 [Medicago truncatula] Length = 111 Score = 58.9 bits (141), Expect = 4e-09 Identities = 33/46 (71%), Positives = 36/46 (78%) Frame = -3 Query: 311 ILYPARKRMREPP*IKFRAAQSLARSLRIGYTSGTLNTKPISKKKV 174 I YPARK+MRE RA QSLA S+RIGYTSGTL TKPISKKK+ Sbjct: 12 ISYPARKQMRE------RATQSLACSVRIGYTSGTLITKPISKKKL 51