BLASTX nr result
ID: Glycyrrhiza29_contig00032061
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza29_contig00032061 (230 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value WP_076864346.1 F0F1 ATP synthase subunit A [Bradyrhizobium sp. S... 111 1e-28 WP_074129613.1 F0F1 ATP synthase subunit A [Bradyrhizobium sp. N... 111 1e-28 WP_028338954.1 MULTISPECIES: F0F1 ATP synthase subunit A [Bradyr... 111 1e-28 WP_028333734.1 F0F1 ATP synthase subunit A [Bradyrhizobium elkanii] 111 1e-28 WP_016847053.1 MULTISPECIES: F0F1 ATP synthase subunit A [Bradyr... 111 1e-28 WP_050630069.1 F0F1 ATP synthase subunit A [Bradyrhizobium virid... 110 2e-28 ERF83940.1 ATP synthase subunit A [Bradyrhizobium sp. DFCI-1] 110 2e-28 WP_027533045.1 F0F1 ATP synthase subunit A [Bradyrhizobium sp. W... 110 3e-28 WP_071916889.1 F0F1 ATP synthase subunit A [Bradyrhizobium japon... 110 4e-28 SFI56861.1 ATP synthase F0 subcomplex A subunit [Bradyrhizobium ... 110 4e-28 SEM87888.1 ATP synthase F0 subcomplex A subunit [Bradyrhizobium ... 110 4e-28 SCB44464.1 ATP synthase F0 subcomplex A subunit [Bradyrhizobium ... 110 4e-28 WP_063980776.1 F0F1 ATP synthase subunit A [Bradyrhizobium sp. G22] 110 4e-28 WP_063197866.1 F0F1 ATP synthase subunit A [Bradyrhizobium sp. A... 110 4e-28 WP_011084006.1 MULTISPECIES: ATP synthase subunit A [Bradyrhizob... 110 4e-28 WP_041748016.1 F0F1 ATP synthase subunit A [Bradyrhizobium sp. S... 110 4e-28 WP_028148710.1 F0F1 ATP synthase subunit A [Bradyrhizobium japon... 110 4e-28 WP_028139850.1 MULTISPECIES: F0F1 ATP synthase subunit A [Bradyr... 110 4e-28 WP_018459993.1 MULTISPECIES: F0F1 ATP synthase subunit A [Bradyr... 110 4e-28 WP_018316339.1 F0F1 ATP synthase subunit A [Bradyrhizobium sp. W... 110 4e-28 >WP_076864346.1 F0F1 ATP synthase subunit A [Bradyrhizobium sp. SEMIA 6399] Length = 249 Score = 111 bits (277), Expect = 1e-28 Identities = 54/54 (100%), Positives = 54/54 (100%) Frame = -1 Query: 230 LGFSLGALGWVGGVLPLALTIALYALELLVAFLQAYVFAILTCIYLNDAIHPGH 69 LGFSLGALGWVGGVLPLALTIALYALELLVAFLQAYVFAILTCIYLNDAIHPGH Sbjct: 196 LGFSLGALGWVGGVLPLALTIALYALELLVAFLQAYVFAILTCIYLNDAIHPGH 249 >WP_074129613.1 F0F1 ATP synthase subunit A [Bradyrhizobium sp. NAS96.2] OKO73009.1 ATP synthase F0F1 subunit A [Bradyrhizobium sp. NAS96.2] Length = 249 Score = 111 bits (277), Expect = 1e-28 Identities = 54/54 (100%), Positives = 54/54 (100%) Frame = -1 Query: 230 LGFSLGALGWVGGVLPLALTIALYALELLVAFLQAYVFAILTCIYLNDAIHPGH 69 LGFSLGALGWVGGVLPLALTIALYALELLVAFLQAYVFAILTCIYLNDAIHPGH Sbjct: 196 LGFSLGALGWVGGVLPLALTIALYALELLVAFLQAYVFAILTCIYLNDAIHPGH 249 >WP_028338954.1 MULTISPECIES: F0F1 ATP synthase subunit A [Bradyrhizobium] Length = 249 Score = 111 bits (277), Expect = 1e-28 Identities = 54/54 (100%), Positives = 54/54 (100%) Frame = -1 Query: 230 LGFSLGALGWVGGVLPLALTIALYALELLVAFLQAYVFAILTCIYLNDAIHPGH 69 LGFSLGALGWVGGVLPLALTIALYALELLVAFLQAYVFAILTCIYLNDAIHPGH Sbjct: 196 LGFSLGALGWVGGVLPLALTIALYALELLVAFLQAYVFAILTCIYLNDAIHPGH 249 >WP_028333734.1 F0F1 ATP synthase subunit A [Bradyrhizobium elkanii] Length = 249 Score = 111 bits (277), Expect = 1e-28 Identities = 54/54 (100%), Positives = 54/54 (100%) Frame = -1 Query: 230 LGFSLGALGWVGGVLPLALTIALYALELLVAFLQAYVFAILTCIYLNDAIHPGH 69 LGFSLGALGWVGGVLPLALTIALYALELLVAFLQAYVFAILTCIYLNDAIHPGH Sbjct: 196 LGFSLGALGWVGGVLPLALTIALYALELLVAFLQAYVFAILTCIYLNDAIHPGH 249 >WP_016847053.1 MULTISPECIES: F0F1 ATP synthase subunit A [Bradyrhizobium] KRP88379.1 ATP synthase F0F1 subunit A [Bradyrhizobium pachyrhizi] ODM70704.1 F0F1 ATP synthase subunit A [Bradyrhizobium elkanii] ODM80144.1 F0F1 ATP synthase subunit A [Bradyrhizobium elkanii] SDC62698.1 ATP synthase F0 subcomplex A subunit [Bradyrhizobium sp. R5] OIM90638.1 F0F1 ATP synthase subunit A [Bradyrhizobium elkanii] OMI04632.1 F0F1 ATP synthase subunit A [Bradyrhizobium sp. UFLA 03-321] Length = 249 Score = 111 bits (277), Expect = 1e-28 Identities = 54/54 (100%), Positives = 54/54 (100%) Frame = -1 Query: 230 LGFSLGALGWVGGVLPLALTIALYALELLVAFLQAYVFAILTCIYLNDAIHPGH 69 LGFSLGALGWVGGVLPLALTIALYALELLVAFLQAYVFAILTCIYLNDAIHPGH Sbjct: 196 LGFSLGALGWVGGVLPLALTIALYALELLVAFLQAYVFAILTCIYLNDAIHPGH 249 >WP_050630069.1 F0F1 ATP synthase subunit A [Bradyrhizobium viridifuturi] Length = 249 Score = 110 bits (276), Expect = 2e-28 Identities = 53/54 (98%), Positives = 54/54 (100%) Frame = -1 Query: 230 LGFSLGALGWVGGVLPLALTIALYALELLVAFLQAYVFAILTCIYLNDAIHPGH 69 LGFSLGALGWVGGVLPLALT+ALYALELLVAFLQAYVFAILTCIYLNDAIHPGH Sbjct: 196 LGFSLGALGWVGGVLPLALTVALYALELLVAFLQAYVFAILTCIYLNDAIHPGH 249 >ERF83940.1 ATP synthase subunit A [Bradyrhizobium sp. DFCI-1] Length = 249 Score = 110 bits (276), Expect = 2e-28 Identities = 53/54 (98%), Positives = 54/54 (100%) Frame = -1 Query: 230 LGFSLGALGWVGGVLPLALTIALYALELLVAFLQAYVFAILTCIYLNDAIHPGH 69 LGFSLGALGWVGGVLPLALT+ALYALELLVAFLQAYVFAILTCIYLNDAIHPGH Sbjct: 196 LGFSLGALGWVGGVLPLALTVALYALELLVAFLQAYVFAILTCIYLNDAIHPGH 249 >WP_027533045.1 F0F1 ATP synthase subunit A [Bradyrhizobium sp. WSM3983] Length = 249 Score = 110 bits (275), Expect = 3e-28 Identities = 53/54 (98%), Positives = 54/54 (100%) Frame = -1 Query: 230 LGFSLGALGWVGGVLPLALTIALYALELLVAFLQAYVFAILTCIYLNDAIHPGH 69 LGFSLGALGWVGGVLPLALTIALYALE+LVAFLQAYVFAILTCIYLNDAIHPGH Sbjct: 196 LGFSLGALGWVGGVLPLALTIALYALEILVAFLQAYVFAILTCIYLNDAIHPGH 249 >WP_071916889.1 F0F1 ATP synthase subunit A [Bradyrhizobium japonicum] APG15783.1 F0F1 ATP synthase subunit A [Bradyrhizobium japonicum] Length = 249 Score = 110 bits (274), Expect = 4e-28 Identities = 52/54 (96%), Positives = 54/54 (100%) Frame = -1 Query: 230 LGFSLGALGWVGGVLPLALTIALYALELLVAFLQAYVFAILTCIYLNDAIHPGH 69 LGFSLGALGWVGGVLPLALT+ALYALE+LVAFLQAYVFAILTCIYLNDAIHPGH Sbjct: 196 LGFSLGALGWVGGVLPLALTVALYALEILVAFLQAYVFAILTCIYLNDAIHPGH 249 >SFI56861.1 ATP synthase F0 subcomplex A subunit [Bradyrhizobium sp. cf659] Length = 249 Score = 110 bits (274), Expect = 4e-28 Identities = 52/54 (96%), Positives = 54/54 (100%) Frame = -1 Query: 230 LGFSLGALGWVGGVLPLALTIALYALELLVAFLQAYVFAILTCIYLNDAIHPGH 69 LGFSLGALGWVGGVLPLALT+ALYALE+LVAFLQAYVFAILTCIYLNDAIHPGH Sbjct: 196 LGFSLGALGWVGGVLPLALTVALYALEILVAFLQAYVFAILTCIYLNDAIHPGH 249 >SEM87888.1 ATP synthase F0 subcomplex A subunit [Bradyrhizobium sp. OK095] Length = 249 Score = 110 bits (274), Expect = 4e-28 Identities = 52/54 (96%), Positives = 54/54 (100%) Frame = -1 Query: 230 LGFSLGALGWVGGVLPLALTIALYALELLVAFLQAYVFAILTCIYLNDAIHPGH 69 LGFSLGALGWVGGVLPLALT+ALYALE+LVAFLQAYVFAILTCIYLNDAIHPGH Sbjct: 196 LGFSLGALGWVGGVLPLALTVALYALEILVAFLQAYVFAILTCIYLNDAIHPGH 249 >SCB44464.1 ATP synthase F0 subcomplex A subunit [Bradyrhizobium sp. err11] Length = 249 Score = 110 bits (274), Expect = 4e-28 Identities = 52/54 (96%), Positives = 54/54 (100%) Frame = -1 Query: 230 LGFSLGALGWVGGVLPLALTIALYALELLVAFLQAYVFAILTCIYLNDAIHPGH 69 LGFSLGALGWVGGVLPLALT+ALYALE+LVAFLQAYVFAILTCIYLNDAIHPGH Sbjct: 196 LGFSLGALGWVGGVLPLALTVALYALEILVAFLQAYVFAILTCIYLNDAIHPGH 249 >WP_063980776.1 F0F1 ATP synthase subunit A [Bradyrhizobium sp. G22] Length = 249 Score = 110 bits (274), Expect = 4e-28 Identities = 52/54 (96%), Positives = 54/54 (100%) Frame = -1 Query: 230 LGFSLGALGWVGGVLPLALTIALYALELLVAFLQAYVFAILTCIYLNDAIHPGH 69 LGFSLGALGWVGGVLPLALT+ALYALE+LVAFLQAYVFAILTCIYLNDAIHPGH Sbjct: 196 LGFSLGALGWVGGVLPLALTVALYALEILVAFLQAYVFAILTCIYLNDAIHPGH 249 >WP_063197866.1 F0F1 ATP synthase subunit A [Bradyrhizobium sp. AT1] KYG22311.1 ATP synthase F0F1 subunit A [Bradyrhizobium sp. AT1] Length = 249 Score = 110 bits (274), Expect = 4e-28 Identities = 52/54 (96%), Positives = 54/54 (100%) Frame = -1 Query: 230 LGFSLGALGWVGGVLPLALTIALYALELLVAFLQAYVFAILTCIYLNDAIHPGH 69 LGFSLGALGWVGGVLPLALT+ALYALE+LVAFLQAYVFAILTCIYLNDAIHPGH Sbjct: 196 LGFSLGALGWVGGVLPLALTVALYALEILVAFLQAYVFAILTCIYLNDAIHPGH 249 >WP_011084006.1 MULTISPECIES: ATP synthase subunit A [Bradyrhizobium] NP_767828.1 ATP synthase F0F1 subunit A [Bradyrhizobium diazoefficiens USDA 110] Q89V68.1 RecName: Full=ATP synthase subunit a; AltName: Full=ATP synthase F0 sector subunit a; AltName: Full=F-ATPase subunit 6 BAC46453.1 FoF1 ATP synthase A chain [Bradyrhizobium diazoefficiens USDA 110] KGJ65645.1 putative FoF1 ATP synthase A chain [Bradyrhizobium diazoefficiens SEMIA 5080] BAR56373.1 F0F1 ATP synthase subunit A [Bradyrhizobium diazoefficiens] KOY07312.1 ATP synthase F0F1 subunit A [Bradyrhizobium japonicum] AND86882.1 ATP synthase F0F1 subunit A [Bradyrhizobium diazoefficiens USDA 110] APO49800.1 ATP synthase F0F1 subunit A [Bradyrhizobium diazoefficiens] Length = 249 Score = 110 bits (274), Expect = 4e-28 Identities = 52/54 (96%), Positives = 54/54 (100%) Frame = -1 Query: 230 LGFSLGALGWVGGVLPLALTIALYALELLVAFLQAYVFAILTCIYLNDAIHPGH 69 LGFSLGALGWVGGVLPLALT+ALYALE+LVAFLQAYVFAILTCIYLNDAIHPGH Sbjct: 196 LGFSLGALGWVGGVLPLALTVALYALEILVAFLQAYVFAILTCIYLNDAIHPGH 249 >WP_041748016.1 F0F1 ATP synthase subunit A [Bradyrhizobium sp. S23321] Length = 249 Score = 110 bits (274), Expect = 4e-28 Identities = 52/54 (96%), Positives = 54/54 (100%) Frame = -1 Query: 230 LGFSLGALGWVGGVLPLALTIALYALELLVAFLQAYVFAILTCIYLNDAIHPGH 69 LGFSLGALGWVGGVLPLALT+ALYALE+LVAFLQAYVFAILTCIYLNDAIHPGH Sbjct: 196 LGFSLGALGWVGGVLPLALTVALYALEILVAFLQAYVFAILTCIYLNDAIHPGH 249 >WP_028148710.1 F0F1 ATP synthase subunit A [Bradyrhizobium japonicum] Length = 249 Score = 110 bits (274), Expect = 4e-28 Identities = 52/54 (96%), Positives = 54/54 (100%) Frame = -1 Query: 230 LGFSLGALGWVGGVLPLALTIALYALELLVAFLQAYVFAILTCIYLNDAIHPGH 69 LGFSLGALGWVGGVLPLALT+ALYALE+LVAFLQAYVFAILTCIYLNDAIHPGH Sbjct: 196 LGFSLGALGWVGGVLPLALTVALYALEILVAFLQAYVFAILTCIYLNDAIHPGH 249 >WP_028139850.1 MULTISPECIES: F0F1 ATP synthase subunit A [Bradyrhizobium] Length = 249 Score = 110 bits (274), Expect = 4e-28 Identities = 52/54 (96%), Positives = 54/54 (100%) Frame = -1 Query: 230 LGFSLGALGWVGGVLPLALTIALYALELLVAFLQAYVFAILTCIYLNDAIHPGH 69 LGFSLGALGWVGGVLPLALT+ALYALE+LVAFLQAYVFAILTCIYLNDAIHPGH Sbjct: 196 LGFSLGALGWVGGVLPLALTVALYALEILVAFLQAYVFAILTCIYLNDAIHPGH 249 >WP_018459993.1 MULTISPECIES: F0F1 ATP synthase subunit A [Bradyrhizobium] Length = 249 Score = 110 bits (274), Expect = 4e-28 Identities = 52/54 (96%), Positives = 54/54 (100%) Frame = -1 Query: 230 LGFSLGALGWVGGVLPLALTIALYALELLVAFLQAYVFAILTCIYLNDAIHPGH 69 LGFSLGALGWVGGVLPLALT+ALYALE+LVAFLQAYVFAILTCIYLNDAIHPGH Sbjct: 196 LGFSLGALGWVGGVLPLALTVALYALEILVAFLQAYVFAILTCIYLNDAIHPGH 249 >WP_018316339.1 F0F1 ATP synthase subunit A [Bradyrhizobium sp. WSM2793] SFM91452.1 ATP synthase F0 subcomplex A subunit [Bradyrhizobium sp. Rc3b] Length = 249 Score = 110 bits (274), Expect = 4e-28 Identities = 52/54 (96%), Positives = 54/54 (100%) Frame = -1 Query: 230 LGFSLGALGWVGGVLPLALTIALYALELLVAFLQAYVFAILTCIYLNDAIHPGH 69 LGFSLGALGWVGGVLPLALT+ALYALE+LVAFLQAYVFAILTCIYLNDAIHPGH Sbjct: 196 LGFSLGALGWVGGVLPLALTVALYALEILVAFLQAYVFAILTCIYLNDAIHPGH 249