BLASTX nr result
ID: Glycyrrhiza29_contig00031943
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza29_contig00031943 (356 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017429980.1 PREDICTED: probable acyl-activating enzyme 6 [Vig... 48 7e-06 >XP_017429980.1 PREDICTED: probable acyl-activating enzyme 6 [Vigna angularis] KOM47114.1 hypothetical protein LR48_Vigan07g081800 [Vigna angularis] BAT81326.1 hypothetical protein VIGAN_03102000 [Vigna angularis var. angularis] Length = 551 Score = 48.1 bits (113), Expect(2) = 7e-06 Identities = 24/36 (66%), Positives = 28/36 (77%) Frame = -1 Query: 254 EPLENSVHILIEGSPLPATVLSPAE*PGFVVSHGTG 147 EPL+N VH+LI GS PA+VL+ AE GFVVSHG G Sbjct: 291 EPLKNPVHVLIGGSTPPASVLARAEEVGFVVSHGYG 326 Score = 28.9 bits (63), Expect(2) = 7e-06 Identities = 13/25 (52%), Positives = 16/25 (64%) Frame = -3 Query: 153 YGMMETLAMVVLYVRKRVWDQFRQR 79 YGM ETL +VV KR WD+ +R Sbjct: 325 YGMTETLGVVVSCAWKREWDRLPRR 349