BLASTX nr result
ID: Glycyrrhiza29_contig00031835
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza29_contig00031835 (271 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value YP_007516891.1 hypothetical protein GlmaxMp43 (mitochondrion) [G... 70 5e-13 KHN28130.1 Putative mitochondrial protein [Glycine soja] 65 3e-10 >YP_007516891.1 hypothetical protein GlmaxMp43 (mitochondrion) [Glycine max] AFR34354.1 hypothetical protein GlmaxMp43 (mitochondrion) [Glycine max] Length = 160 Score = 69.7 bits (169), Expect = 5e-13 Identities = 33/35 (94%), Positives = 35/35 (100%) Frame = -3 Query: 107 LLLLTIQSSHSWKTMHGMLFQLCVHVLIFVMLAFF 3 +LLLTIQSSHS+KTMHGMLFQLCVHVLIFVMLAFF Sbjct: 61 VLLLTIQSSHSFKTMHGMLFQLCVHVLIFVMLAFF 95 >KHN28130.1 Putative mitochondrial protein [Glycine soja] Length = 443 Score = 64.7 bits (156), Expect = 3e-10 Identities = 31/35 (88%), Positives = 34/35 (97%) Frame = -3 Query: 107 LLLLTIQSSHSWKTMHGMLFQLCVHVLIFVMLAFF 3 +LLL IQSS+S+KTMHGMLFQLCVHVLIFVMLAFF Sbjct: 169 VLLLIIQSSNSFKTMHGMLFQLCVHVLIFVMLAFF 203