BLASTX nr result
ID: Glycyrrhiza29_contig00031755
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza29_contig00031755 (280 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KJB62219.1 hypothetical protein B456_009G406600 [Gossypium raimo... 69 1e-12 >KJB62219.1 hypothetical protein B456_009G406600 [Gossypium raimondii] Length = 174 Score = 69.3 bits (168), Expect = 1e-12 Identities = 33/35 (94%), Positives = 35/35 (100%) Frame = +3 Query: 174 LGLQSALIAQLFDNSLSAFMCSAFRSYPFRAPFLK 278 LGLQSALIAQLF+NSLSAF+CSAFRSYPFRAPFLK Sbjct: 18 LGLQSALIAQLFENSLSAFVCSAFRSYPFRAPFLK 52