BLASTX nr result
ID: Glycyrrhiza29_contig00031533
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza29_contig00031533 (454 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_012570033.1 PREDICTED: uncharacterized protein LOC101514891 [... 55 1e-08 GAU16941.1 hypothetical protein TSUD_36990 [Trifolium subterraneum] 49 5e-06 >XP_012570033.1 PREDICTED: uncharacterized protein LOC101514891 [Cicer arietinum] Length = 253 Score = 55.1 bits (131), Expect(2) = 1e-08 Identities = 26/35 (74%), Positives = 29/35 (82%) Frame = -2 Query: 162 ARMQNFSVRNYRVGQPDLFSDENKTISIEMHLKRD 58 +RMQN SVRNY +GQP LFS ENKT + EMHLKRD Sbjct: 6 SRMQNNSVRNYLIGQPGLFSVENKTSNTEMHLKRD 40 Score = 31.6 bits (70), Expect(2) = 1e-08 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = -3 Query: 56 AQGNNGTQSYIQDETIDA 3 AQGNNG QSYI DE DA Sbjct: 57 AQGNNGIQSYIPDEPTDA 74 >GAU16941.1 hypothetical protein TSUD_36990 [Trifolium subterraneum] Length = 264 Score = 48.9 bits (115), Expect(2) = 5e-06 Identities = 23/33 (69%), Positives = 25/33 (75%) Frame = -2 Query: 156 MQNFSVRNYRVGQPDLFSDENKTISIEMHLKRD 58 MQN SVR Y VGQP LFSDENKT++ E H RD Sbjct: 1 MQNNSVRKYLVGQPGLFSDENKTLNAETHSTRD 33 Score = 28.5 bits (62), Expect(2) = 5e-06 Identities = 12/18 (66%), Positives = 14/18 (77%) Frame = -3 Query: 56 AQGNNGTQSYIQDETIDA 3 AQGNN QSYI D+ +DA Sbjct: 58 AQGNNVIQSYIPDDLVDA 75