BLASTX nr result
ID: Glycyrrhiza29_contig00031293
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza29_contig00031293 (236 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AFK34752.1 unknown [Medicago truncatula] 66 2e-12 XP_014632416.1 PREDICTED: flotillin-like protein 3 [Glycine max] 63 8e-11 XP_007226306.1 hypothetical protein PRUPE_ppa020951mg [Prunus pe... 66 8e-11 XP_003603336.2 SPFH/band 7/PHB domain membrane-associated family... 66 8e-11 XP_003591134.1 SPFH/band 7/PHB domain membrane-associated family... 66 8e-11 XP_013470396.1 SPFH/band 7/PHB domain membrane-associated family... 66 8e-11 XP_013468625.1 SPFH/band 7/PHB domain membrane-associated family... 66 8e-11 XP_013461876.1 SPFH/band 7/PHB domain membrane-associated family... 66 8e-11 XP_003603333.2 SPFH/band 7/PHB domain membrane-associated family... 66 8e-11 XP_007224585.1 hypothetical protein PRUPE_ppa1027148mg [Prunus p... 66 8e-11 XP_007222834.1 hypothetical protein PRUPE_ppa005113mg [Prunus pe... 66 8e-11 XP_009382095.1 PREDICTED: flotillin-like protein 1 [Musa acumina... 66 8e-11 XP_008219544.1 PREDICTED: flotillin-like protein 4 [Prunus mume] 66 8e-11 XP_003603332.1 SPFH/band 7/PHB domain membrane-associated family... 66 8e-11 XP_008219545.1 PREDICTED: uncharacterized protein LOC103319738 i... 66 8e-11 XP_017257372.1 PREDICTED: flotillin-like protein 3 [Daucus carot... 65 1e-10 XP_017421294.1 PREDICTED: flotillin-like protein 4 [Vigna angula... 65 1e-10 OMP12228.1 hypothetical protein COLO4_03388, partial [Corchorus ... 63 2e-10 XP_007136987.1 hypothetical protein PHAVU_009G090700g [Phaseolus... 65 2e-10 NP_001237748.1 nodulin [Glycine max] AAC72337.1 nodulin [Glycine... 65 2e-10 >AFK34752.1 unknown [Medicago truncatula] Length = 79 Score = 65.9 bits (159), Expect = 2e-12 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = -1 Query: 203 KEVANVYKMLPPLFKTVHEQTGMLPPAWMG 114 KEVA VYKMLPPLFKTVHEQTGMLPPAWMG Sbjct: 42 KEVAGVYKMLPPLFKTVHEQTGMLPPAWMG 71 >XP_014632416.1 PREDICTED: flotillin-like protein 3 [Glycine max] Length = 126 Score = 62.8 bits (151), Expect = 8e-11 Identities = 28/30 (93%), Positives = 28/30 (93%) Frame = -1 Query: 203 KEVANVYKMLPPLFKTVHEQTGMLPPAWMG 114 KEVA VYKMLPPLFKTV EQTGMLPPAWMG Sbjct: 90 KEVAGVYKMLPPLFKTVQEQTGMLPPAWMG 119 >XP_007226306.1 hypothetical protein PRUPE_ppa020951mg [Prunus persica] Length = 431 Score = 65.9 bits (159), Expect = 8e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = -1 Query: 203 KEVANVYKMLPPLFKTVHEQTGMLPPAWMG 114 KEVA VYKMLPPLFKTVHEQTGMLPPAWMG Sbjct: 389 KEVAEVYKMLPPLFKTVHEQTGMLPPAWMG 418 >XP_003603336.2 SPFH/band 7/PHB domain membrane-associated family protein [Medicago truncatula] AES73587.2 SPFH/band 7/PHB domain membrane-associated family protein [Medicago truncatula] Length = 453 Score = 65.9 bits (159), Expect = 8e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = -1 Query: 203 KEVANVYKMLPPLFKTVHEQTGMLPPAWMG 114 KEVA VYKMLPPLFKTVHEQTGMLPPAWMG Sbjct: 417 KEVAGVYKMLPPLFKTVHEQTGMLPPAWMG 446 >XP_003591134.1 SPFH/band 7/PHB domain membrane-associated family protein [Medicago truncatula] D2XNR2.1 RecName: Full=Flotillin-like protein 6 ADA83098.1 flotillin-like protein 6 [Medicago truncatula] AES61385.1 SPFH/band 7/PHB domain membrane-associated family protein [Medicago truncatula] Length = 472 Score = 65.9 bits (159), Expect = 8e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = -1 Query: 203 KEVANVYKMLPPLFKTVHEQTGMLPPAWMG 114 KEVA VYKMLPPLFKTVHEQTGMLPPAWMG Sbjct: 436 KEVAGVYKMLPPLFKTVHEQTGMLPPAWMG 465 >XP_013470396.1 SPFH/band 7/PHB domain membrane-associated family protein [Medicago truncatula] KEH44434.1 SPFH/band 7/PHB domain membrane-associated family protein [Medicago truncatula] Length = 473 Score = 65.9 bits (159), Expect = 8e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = -1 Query: 203 KEVANVYKMLPPLFKTVHEQTGMLPPAWMG 114 KEVA VYKMLPPLFKTVHEQTGMLPPAWMG Sbjct: 437 KEVAGVYKMLPPLFKTVHEQTGMLPPAWMG 466 >XP_013468625.1 SPFH/band 7/PHB domain membrane-associated family protein [Medicago truncatula] KEH42662.1 SPFH/band 7/PHB domain membrane-associated family protein [Medicago truncatula] Length = 474 Score = 65.9 bits (159), Expect = 8e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = -1 Query: 203 KEVANVYKMLPPLFKTVHEQTGMLPPAWMG 114 KEVA VYKMLPPLFKTVHEQTGMLPPAWMG Sbjct: 438 KEVAGVYKMLPPLFKTVHEQTGMLPPAWMG 467 >XP_013461876.1 SPFH/band 7/PHB domain membrane-associated family protein [Medicago truncatula] D2XNR0.1 RecName: Full=Flotillin-like protein 3 ADA83096.1 flotillin-like protein 3 [Medicago truncatula] KEH35911.1 SPFH/band 7/PHB domain membrane-associated family protein [Medicago truncatula] Length = 474 Score = 65.9 bits (159), Expect = 8e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = -1 Query: 203 KEVANVYKMLPPLFKTVHEQTGMLPPAWMG 114 KEVA VYKMLPPLFKTVHEQTGMLPPAWMG Sbjct: 438 KEVAGVYKMLPPLFKTVHEQTGMLPPAWMG 467 >XP_003603333.2 SPFH/band 7/PHB domain membrane-associated family protein [Medicago truncatula] D2XNR1.1 RecName: Full=Flotillin-like protein 4 ADA83097.1 flotillin-like protein 4 [Medicago truncatula] AES73584.2 SPFH/band 7/PHB domain membrane-associated family protein [Medicago truncatula] Length = 475 Score = 65.9 bits (159), Expect = 8e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = -1 Query: 203 KEVANVYKMLPPLFKTVHEQTGMLPPAWMG 114 KEVA VYKMLPPLFKTVHEQTGMLPPAWMG Sbjct: 438 KEVAGVYKMLPPLFKTVHEQTGMLPPAWMG 467 >XP_007224585.1 hypothetical protein PRUPE_ppa1027148mg [Prunus persica] ONI34512.1 hypothetical protein PRUPE_1G485400 [Prunus persica] Length = 476 Score = 65.9 bits (159), Expect = 8e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = -1 Query: 203 KEVANVYKMLPPLFKTVHEQTGMLPPAWMG 114 KEVA VYKMLPPLFKTVHEQTGMLPPAWMG Sbjct: 438 KEVAGVYKMLPPLFKTVHEQTGMLPPAWMG 467 >XP_007222834.1 hypothetical protein PRUPE_ppa005113mg [Prunus persica] ONI34513.1 hypothetical protein PRUPE_1G485500 [Prunus persica] Length = 476 Score = 65.9 bits (159), Expect = 8e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = -1 Query: 203 KEVANVYKMLPPLFKTVHEQTGMLPPAWMG 114 KEVA VYKMLPPLFKTVHEQTGMLPPAWMG Sbjct: 438 KEVAGVYKMLPPLFKTVHEQTGMLPPAWMG 467 >XP_009382095.1 PREDICTED: flotillin-like protein 1 [Musa acuminata subsp. malaccensis] Length = 477 Score = 65.9 bits (159), Expect = 8e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = -1 Query: 203 KEVANVYKMLPPLFKTVHEQTGMLPPAWMG 114 KEVA VYKMLPPLFKTVHEQTGMLPPAWMG Sbjct: 440 KEVAGVYKMLPPLFKTVHEQTGMLPPAWMG 469 >XP_008219544.1 PREDICTED: flotillin-like protein 4 [Prunus mume] Length = 479 Score = 65.9 bits (159), Expect = 8e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = -1 Query: 203 KEVANVYKMLPPLFKTVHEQTGMLPPAWMG 114 KEVA VYKMLPPLFKTVHEQTGMLPPAWMG Sbjct: 441 KEVAGVYKMLPPLFKTVHEQTGMLPPAWMG 470 >XP_003603332.1 SPFH/band 7/PHB domain membrane-associated family protein [Medicago truncatula] D2XNQ9.1 RecName: Full=Flotillin-like protein 2 ADA83095.1 flotillin-like protein 2 [Medicago truncatula] AES73583.1 SPFH/band 7/PHB domain membrane-associated family protein [Medicago truncatula] Length = 480 Score = 65.9 bits (159), Expect = 8e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = -1 Query: 203 KEVANVYKMLPPLFKTVHEQTGMLPPAWMG 114 KEVA VYKMLPPLFKTVHEQTGMLPPAWMG Sbjct: 444 KEVAGVYKMLPPLFKTVHEQTGMLPPAWMG 473 >XP_008219545.1 PREDICTED: uncharacterized protein LOC103319738 isoform X1 [Prunus mume] Length = 970 Score = 65.9 bits (159), Expect = 8e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = -1 Query: 203 KEVANVYKMLPPLFKTVHEQTGMLPPAWMG 114 KEVA VYKMLPPLFKTVHEQTGMLPPAWMG Sbjct: 440 KEVAEVYKMLPPLFKTVHEQTGMLPPAWMG 469 Score = 62.4 bits (150), Expect = 1e-09 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -1 Query: 203 KEVANVYKMLPPLFKTVHEQTGMLPPAWMG 114 KEVA VYKMLPPL KTVHEQTGMLPP+WMG Sbjct: 926 KEVAGVYKMLPPLLKTVHEQTGMLPPSWMG 955 >XP_017257372.1 PREDICTED: flotillin-like protein 3 [Daucus carota subsp. sativus] KZM92081.1 hypothetical protein DCAR_020554 [Daucus carota subsp. sativus] Length = 472 Score = 65.5 bits (158), Expect = 1e-10 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -1 Query: 203 KEVANVYKMLPPLFKTVHEQTGMLPPAWMG 114 KE+A VYKMLPPLFKTVHEQTGMLPPAWMG Sbjct: 437 KEIAGVYKMLPPLFKTVHEQTGMLPPAWMG 466 >XP_017421294.1 PREDICTED: flotillin-like protein 4 [Vigna angularis] KOM42022.1 hypothetical protein LR48_Vigan04g222000 [Vigna angularis] BAT78132.1 hypothetical protein VIGAN_02077300 [Vigna angularis var. angularis] Length = 474 Score = 65.1 bits (157), Expect = 1e-10 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -1 Query: 203 KEVANVYKMLPPLFKTVHEQTGMLPPAWMG 114 K+VANVYKMLPPLF TVHEQTGMLPPAWMG Sbjct: 438 KDVANVYKMLPPLFNTVHEQTGMLPPAWMG 467 >OMP12228.1 hypothetical protein COLO4_03388, partial [Corchorus olitorius] Length = 174 Score = 62.8 bits (151), Expect = 2e-10 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -1 Query: 203 KEVANVYKMLPPLFKTVHEQTGMLPPAWMG 114 KEVA VY+MLPPLFKTVHEQTGMLPP WMG Sbjct: 133 KEVAGVYRMLPPLFKTVHEQTGMLPPPWMG 162 >XP_007136987.1 hypothetical protein PHAVU_009G090700g [Phaseolus vulgaris] ESW08981.1 hypothetical protein PHAVU_009G090700g [Phaseolus vulgaris] Length = 474 Score = 64.7 bits (156), Expect = 2e-10 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -1 Query: 203 KEVANVYKMLPPLFKTVHEQTGMLPPAWMG 114 K+VA VYKMLPPLFKTVHEQTGMLPPAWMG Sbjct: 438 KDVAGVYKMLPPLFKTVHEQTGMLPPAWMG 467 >NP_001237748.1 nodulin [Glycine max] AAC72337.1 nodulin [Glycine max] KHN07051.1 Flotillin-like protein 1 [Glycine soja] KRH52390.1 hypothetical protein GLYMA_06G065600 [Glycine max] KRH52391.1 hypothetical protein GLYMA_06G065600 [Glycine max] Length = 476 Score = 64.7 bits (156), Expect = 2e-10 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -1 Query: 203 KEVANVYKMLPPLFKTVHEQTGMLPPAWMG 114 K+VA VYKMLPPLFKTVHEQTGMLPPAWMG Sbjct: 440 KDVAGVYKMLPPLFKTVHEQTGMLPPAWMG 469