BLASTX nr result
ID: Glycyrrhiza29_contig00030781
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza29_contig00030781 (417 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value YP_173477.1 hypothetical protein NitaMp140 [Nicotiana tabacum] B... 83 5e-18 NP_064104.1 orf110b gene product (mitochondrion) [Beta vulgaris ... 80 7e-17 KJB09734.1 hypothetical protein B456_001G161000, partial [Gossyp... 79 3e-15 >YP_173477.1 hypothetical protein NitaMp140 [Nicotiana tabacum] BAD83543.1 hypothetical protein (mitochondrion) [Nicotiana tabacum] Length = 116 Score = 83.2 bits (204), Expect = 5e-18 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = +1 Query: 1 GFEPLTQGFSVLCSNQLSYLNHFPKVCFLHRIAPYLT 111 GFEPLTQGFSVLCSNQLSYLNHFPKVCFLHRIAPYLT Sbjct: 79 GFEPLTQGFSVLCSNQLSYLNHFPKVCFLHRIAPYLT 115 >NP_064104.1 orf110b gene product (mitochondrion) [Beta vulgaris subsp. vulgaris] YP_004222346.1 hypothetical protein BevumaM_p112 (mitochondrion) [Beta vulgaris subsp. maritima] YP_004842151.1 hypothetical protein BemaM_p107 (mitochondrion) [Beta macrocarpa] BAA99498.1 orf110b (mitochondrion) [Beta vulgaris subsp. vulgaris] CBJ14076.1 hypothetical protein (mitochondrion) [Beta vulgaris subsp. maritima] CBJ17566.1 hypothetical protein (mitochondrion) [Beta vulgaris subsp. maritima] CBJ20714.1 hypothetical protein (mitochondrion) [Beta vulgaris subsp. maritima] CBX24956.1 hypothetical protein (mitochondrion) [Beta macrocarpa] CBL51962.1 hypothetical protein (mitochondrion) [Beta vulgaris subsp. maritima] Length = 110 Score = 80.1 bits (196), Expect = 7e-17 Identities = 40/45 (88%), Positives = 41/45 (91%) Frame = +1 Query: 1 GFEPLTQGFSVLCSNQLSYLNHFPKVCFLHRIAPYLTYHLTSQGK 135 GFEPLTQGFSVLCSNQLSYLNHFPKVCFLHRIAPY T+ L SQ K Sbjct: 49 GFEPLTQGFSVLCSNQLSYLNHFPKVCFLHRIAPY-TFFL-SQNK 91 >KJB09734.1 hypothetical protein B456_001G161000, partial [Gossypium raimondii] Length = 244 Score = 79.3 bits (194), Expect = 3e-15 Identities = 36/37 (97%), Positives = 36/37 (97%) Frame = +1 Query: 1 GFEPLTQGFSVLCSNQLSYLNHFPKVCFLHRIAPYLT 111 GFEPLTQGFSVLCSNQLSYLNHFPKV FLHRIAPYLT Sbjct: 105 GFEPLTQGFSVLCSNQLSYLNHFPKVSFLHRIAPYLT 141