BLASTX nr result
ID: Glycyrrhiza29_contig00030764
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza29_contig00030764 (320 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KYP75671.1 RanBP2-type zinc finger protein At1g67325 [Cajanus ca... 103 2e-25 BAT86626.1 hypothetical protein VIGAN_04429800 [Vigna angularis ... 84 5e-21 XP_013461218.1 Zn-finger, RanBP-type, containing protein [Medica... 67 7e-11 XP_019414710.1 PREDICTED: ranBP2-type zinc finger protein At1g67... 53 6e-06 XP_019414709.1 PREDICTED: ranBP2-type zinc finger protein At1g67... 53 6e-06 XP_019414708.1 PREDICTED: ranBP2-type zinc finger protein At1g67... 53 6e-06 OIV98467.1 hypothetical protein TanjilG_16794 [Lupinus angustifo... 53 7e-06 >KYP75671.1 RanBP2-type zinc finger protein At1g67325 [Cajanus cajan] Length = 215 Score = 103 bits (257), Expect = 2e-25 Identities = 51/89 (57%), Positives = 63/89 (70%) Frame = -2 Query: 313 DQNDEVCCVKHFHFANLRSFLLQLMVFHEQLCDIVNIFKWKAVVKWLIMWIHWTLWKSLT 134 DQ+D+VCCVK+ HF +L S L QL VF EQLC+I+ I KW+AVVK WI LWKS + Sbjct: 135 DQSDQVCCVKYIHFVSLHSLLQQLWVFREQLCNIMYILKWEAVVKLPFKWI---LWKSFS 191 Query: 133 FASCHLDPFVQLTDTHTYFISFISIHCNL 47 FAS HL+PF +T+ IS +SIHCNL Sbjct: 192 FASFHLEPFY-----YTFLISSVSIHCNL 215 >BAT86626.1 hypothetical protein VIGAN_04429800 [Vigna angularis var. angularis] Length = 390 Score = 83.6 bits (205), Expect(2) = 5e-21 Identities = 44/80 (55%), Positives = 53/80 (66%) Frame = -2 Query: 319 SPDQNDEVCCVKHFHFANLRSFLLQLMVFHEQLCDIVNIFKWKAVVKWLIMWIHWTLWKS 140 S DQND+VCC+K FHF NL LLQ +VF EQLCD++NIFK ++VVK WI L KS Sbjct: 277 SADQNDQVCCLKCFHFVNLH-LLLQQLVFQEQLCDMMNIFKLQSVVKLSFKWI---LRKS 332 Query: 139 LTFASCHLDPFVQLTDTHTY 80 +FAS HL PF +Y Sbjct: 333 FSFASIHLKPFCYTFSVSSY 352 Score = 44.7 bits (104), Expect(2) = 5e-21 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = -3 Query: 66 YLFIAIFNLQLFTVPVSTRTCL 1 YL IAIFNLQLFTVPVSTRTCL Sbjct: 352 YLSIAIFNLQLFTVPVSTRTCL 373 >XP_013461218.1 Zn-finger, RanBP-type, containing protein [Medicago truncatula] KEH35253.1 Zn-finger, RanBP-type, containing protein [Medicago truncatula] Length = 332 Score = 67.0 bits (162), Expect = 7e-11 Identities = 33/49 (67%), Positives = 37/49 (75%) Frame = -2 Query: 319 SPDQNDEVCCVKHFHFANLRSFLLQLMVFHEQLCDIVNIFKWKAVVKWL 173 SPDQN++VC VK F A L L Q +VFHEQLCDIVNIFK KAVV +L Sbjct: 278 SPDQNEQVCYVKPFQSAKLHLLLQQRLVFHEQLCDIVNIFKLKAVVMFL 326 >XP_019414710.1 PREDICTED: ranBP2-type zinc finger protein At1g67325-like isoform X3 [Lupinus angustifolius] Length = 323 Score = 53.1 bits (126), Expect = 6e-06 Identities = 24/45 (53%), Positives = 31/45 (68%) Frame = -2 Query: 316 PDQNDEVCCVKHFHFANLRSFLLQLMVFHEQLCDIVNIFKWKAVV 182 P QND+VCCV +FHFANL L QL+ F + LC+ +NI + VV Sbjct: 279 PVQNDQVCCVNYFHFANLNWLLRQLLTFQDILCNTMNILIRQIVV 323 >XP_019414709.1 PREDICTED: ranBP2-type zinc finger protein At1g67325-like isoform X2 [Lupinus angustifolius] Length = 324 Score = 53.1 bits (126), Expect = 6e-06 Identities = 24/45 (53%), Positives = 31/45 (68%) Frame = -2 Query: 316 PDQNDEVCCVKHFHFANLRSFLLQLMVFHEQLCDIVNIFKWKAVV 182 P QND+VCCV +FHFANL L QL+ F + LC+ +NI + VV Sbjct: 280 PVQNDQVCCVNYFHFANLNWLLRQLLTFQDILCNTMNILIRQIVV 324 >XP_019414708.1 PREDICTED: ranBP2-type zinc finger protein At1g67325-like isoform X1 [Lupinus angustifolius] Length = 325 Score = 53.1 bits (126), Expect = 6e-06 Identities = 24/45 (53%), Positives = 31/45 (68%) Frame = -2 Query: 316 PDQNDEVCCVKHFHFANLRSFLLQLMVFHEQLCDIVNIFKWKAVV 182 P QND+VCCV +FHFANL L QL+ F + LC+ +NI + VV Sbjct: 281 PVQNDQVCCVNYFHFANLNWLLRQLLTFQDILCNTMNILIRQIVV 325 >OIV98467.1 hypothetical protein TanjilG_16794 [Lupinus angustifolius] Length = 621 Score = 53.1 bits (126), Expect = 7e-06 Identities = 24/45 (53%), Positives = 31/45 (68%) Frame = -2 Query: 316 PDQNDEVCCVKHFHFANLRSFLLQLMVFHEQLCDIVNIFKWKAVV 182 P QND+VCCV +FHFANL L QL+ F + LC+ +NI + VV Sbjct: 577 PVQNDQVCCVNYFHFANLNWLLRQLLTFQDILCNTMNILIRQIVV 621