BLASTX nr result
ID: Glycyrrhiza29_contig00030595
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza29_contig00030595 (338 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_013463179.1 hypothetical protein MTR_2g435690 [Medicago trunc... 61 6e-10 KHN26524.1 hypothetical protein glysoja_019763 [Glycine soja] 53 7e-07 >XP_013463179.1 hypothetical protein MTR_2g435690 [Medicago truncatula] XP_013463180.1 hypothetical protein MTR_2g435720 [Medicago truncatula] KEH37194.1 hypothetical protein MTR_2g435690 [Medicago truncatula] KEH37195.1 hypothetical protein MTR_2g435720 [Medicago truncatula] Length = 91 Score = 60.8 bits (146), Expect = 6e-10 Identities = 27/41 (65%), Positives = 33/41 (80%) Frame = +3 Query: 216 RWGLQGTQEQYNKGKPIINSKEAAYNYGGINVVNYPKTKPQ 338 R G Q Q QYNK + +INSK+AAY+YGGI VVNYPKT+P+ Sbjct: 39 RKGFQANQYQYNKEETVINSKDAAYSYGGIMVVNYPKTRPK 79 >KHN26524.1 hypothetical protein glysoja_019763 [Glycine soja] Length = 94 Score = 53.1 bits (126), Expect = 7e-07 Identities = 25/42 (59%), Positives = 31/42 (73%), Gaps = 1/42 (2%) Frame = +3 Query: 216 RWGLQGTQEQYNKGKPIINSKEAAYNYGGINVVN-YPKTKPQ 338 RWG+Q T + + + +INSKEAA +GGI VVN YPKTKPQ Sbjct: 41 RWGVQATHQSHKEEPVVINSKEAASKFGGIMVVNYYPKTKPQ 82