BLASTX nr result
ID: Glycyrrhiza29_contig00030487
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza29_contig00030487 (390 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006578305.1 PREDICTED: pentatricopeptide repeat-containing pr... 55 3e-06 XP_006578304.1 PREDICTED: pentatricopeptide repeat-containing pr... 55 3e-06 KHN08291.1 Pentatricopeptide repeat-containing protein [Glycine ... 55 3e-06 XP_006578303.1 PREDICTED: pentatricopeptide repeat-containing pr... 55 3e-06 >XP_006578305.1 PREDICTED: pentatricopeptide repeat-containing protein At5g27460-like isoform X3 [Glycine max] Length = 542 Score = 55.1 bits (131), Expect = 3e-06 Identities = 28/42 (66%), Positives = 33/42 (78%), Gaps = 2/42 (4%) Frame = +3 Query: 24 LHEDKVEMDSETFSILEAFTG--*AEVFGGAAVIWNSIFSLG 143 + EDK+EMD+ET SIL+AFTG AEVFGG AV WNS+ LG Sbjct: 501 MDEDKIEMDNETLSILKAFTGCVQAEVFGGEAVTWNSVSFLG 542 >XP_006578304.1 PREDICTED: pentatricopeptide repeat-containing protein At5g27460-like isoform X2 [Glycine max] Length = 550 Score = 55.1 bits (131), Expect = 3e-06 Identities = 28/42 (66%), Positives = 33/42 (78%), Gaps = 2/42 (4%) Frame = +3 Query: 24 LHEDKVEMDSETFSILEAFTG--*AEVFGGAAVIWNSIFSLG 143 + EDK+EMD+ET SIL+AFTG AEVFGG AV WNS+ LG Sbjct: 476 MDEDKIEMDNETLSILKAFTGCVQAEVFGGEAVTWNSVSFLG 517 >KHN08291.1 Pentatricopeptide repeat-containing protein [Glycine soja] Length = 575 Score = 55.1 bits (131), Expect = 3e-06 Identities = 28/42 (66%), Positives = 33/42 (78%), Gaps = 2/42 (4%) Frame = +3 Query: 24 LHEDKVEMDSETFSILEAFTG--*AEVFGGAAVIWNSIFSLG 143 + EDK+EMD+ET SIL+AFTG AEVFGG AV WNS+ LG Sbjct: 501 MDEDKIEMDNETLSILKAFTGCVQAEVFGGEAVTWNSVSFLG 542 >XP_006578303.1 PREDICTED: pentatricopeptide repeat-containing protein At5g27460-like isoform X1 [Glycine max] KRH62276.1 hypothetical protein GLYMA_04G097400 [Glycine max] Length = 575 Score = 55.1 bits (131), Expect = 3e-06 Identities = 28/42 (66%), Positives = 33/42 (78%), Gaps = 2/42 (4%) Frame = +3 Query: 24 LHEDKVEMDSETFSILEAFTG--*AEVFGGAAVIWNSIFSLG 143 + EDK+EMD+ET SIL+AFTG AEVFGG AV WNS+ LG Sbjct: 501 MDEDKIEMDNETLSILKAFTGCVQAEVFGGEAVTWNSVSFLG 542